You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNicotinamide riboside kinase
Synonyms
  • NRK
  • NmR-K
  • Nicotinic acid riboside kinase
  • Ribosylnicotinamide kinase
  • RNK
  • Ribosylnicotinic acid kinase
Gene NameNRK1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionCatalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN)
Cellular LocationNot Available
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
SMPDB Reactions
Nicotinamide riboside + Adenosine triphosphateNicotinamide ribotide + ADP + hydron
Adenosine triphosphate + Nicotinate D-ribonucleosideADP + hydron + nicotinic acid D-ribonucleotide
KEGG Reactions
Adenosine triphosphate + Nicotinamide ribosidehydron + Nicotinamide ribotide + ADP
Metabolites
YMDB IDNameView
YMDB00103Nicotinamide ribosideShow
YMDB00109Adenosine triphosphateShow
YMDB00138Nicotinamide ribotideShow
YMDB00157Nicotinate D-ribonucleosideShow
YMDB00193Nicotinic acid mononucleotideShow
YMDB00741nicotinic acid D-ribonucleotideShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
kinase activity
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL129W
Gene Sequence>723 bp ATGACTTCGAAAAAAGTGATATTAGTTGCATTGAGTGGATGCTCCTCCAGTGGTAAGACG ACAATTGCGAAACTTACAGCAAGTTTATTCACGAAGGCTACATTAATTCATGAAGATGAC TTTTACAAACATGATAATGAAGTGCCAGTAGATGCTAAATATAACATTCAAAATTGGGAT TCGCCAGAAGCTCTTGATTTTAAACTTTTCGGTAAAGAATTAGATGTGATCAAACAAACT GGTAAAATAGCCACCAAACTTATACACAATAACAACGTAGATGATCCCTTTACAAAGTTC CACATTGATAGACAAGTTTGGGACGAGTTAAAGGCTAAGTATGACTCTATTAATGACGAC AAATATGAAGTTGTAATTGTAGATGGGTTTATGATTTTCAATAATACTGGAATATCAAAA AAATTTGATTTGAAGATATTAGTGCGTGCTCCCTATGAAGTACTAAAAAAAAGGAGGGCT TCCAGAAAAGGATACCAGACTTTGGATTCTTTCTGGGTGGATCCGCCGTATTATTTCGAC GAATTTGTGTATGAATCTTATCGTGCAAATCATGCGCAGTTATTTGTTAATGGAGACGTA GAAGGTTTACTAGACCCAAGGAAGTCAAAGAATATAAAAGAGTTCATAAATGATGATGAC ACTCCAATTGCGAAACCTTTAAGCTGGGTGTGCCAAGAGATTCTAAAGCTTTGTAAGGAT TAG
Protein Properties
Pfam Domain Function
Protein Residues240
Protein Molecular Weight27689.30078
Protein Theoretical pI6.68
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Nicotinamide riboside kinase MTSKKVILVALSGCSSSGKTTIAKLTASLFTKATLIHEDDFYKHDNEVPVDAKYNIQNWD SPEALDFKLFGKELDVIKQTGKIATKLIHNNNVDDPFTKFHIDRQVWDELKAKYDSINDD KYEVVIVDGFMIFNNTGISKKFDLKILVRAPYEVLKKRRASRKGYQTLDSFWVDPPYYFD EFVYESYRANHAQLFVNGDVEGLLDPRKSKNIKEFINDDDTPIAKPLSWVCQEILKLCKD
References
External Links
ResourceLink
Saccharomyces Genome Database NRK1
Uniprot IDP53915
Uniprot NameNRK1_YEAST
GenBank Gene IDAY558011
Genebank Protein ID45269912
General Reference
  • Bieganowski, P., Brenner, C. (2004). "Discoveries of nicotinamide riboside as a nutrient and conserved NRK genes establish a Preiss-Handler independent route to NAD+ in fungi and humans." Cell 117:495-502.15137942
  • Mallet, L., Bussereau, F., Jacquet, M. (1995). "A 43.5 kb segment of yeast chromosome XIV, which contains MFA2, MEP2, CAP/SRV2, NAM9, FKB1/FPR1/RBP1, MOM22 and CPT1, predicts an adenosine deaminase gene and 14 new open reading frames." Yeast 11:1195-1209.8619318
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106