You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative 2-hydroxyacid dehydrogenase YNL274C
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Specific FunctionNot Available
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00033Glyoxylic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00807glycolic acidShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
nucleotide binding
oxidoreductase activity
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
NAD or NADH binding
catalytic activity
binding
Process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYNL274C
Gene Sequence>1053 bp ATGAGTAAGAAACCAATTGTTTTGAAATTAGGAAAGGATGCCTTTGGTGACCAAGCCTGG GGGGAATTGGAAAAGATTGCGGATGTAATTACCATCCCTGAATCCACCACTAGAGAACAG TTTTTGCGGGAGGTAAAAGACCCACAAAATAAGCTCTCCCAAGTACAAGTCATTACTAGA ACAGCAAGGAGTGTGAAAAACACCGGTAGATTTGATGAAGAGCTTGCTCTTGCTTTGCCC TCCTCCGTAGTGGCTGTATGTCATACTGGTGCTGGTTATGACCAAATTGATGTTGAGCCA TTCAAGAAAAGGCACATCCAGGTTGCCAATGTTCCTGATTTAGTTAGCAATGCTACCGCT GATACGCATGTATTTTTGCTATTGGGTGCCCTAAGAAACTTCGGTATTGGTAACAGAAGG TTGATCGAGGGAAACTGGCCGGAGGCAGGACCCGCATGTGGTTCTCCCTTTGGATACGAC CCTGAAGGGAAAACAGTTGGTATACTGGGTCTAGGTAGGATTGGTCGTTGTATTTTAGAG AGATTGAAGCCGTTTGGGTTCGAGAATTTCATATATCATAACAGACACCAGCTTCCTTCC GAAGAAGAGCATGGTTGTGAATATGTAGGATTCGAGGAGTTTTTGAAGCGTTCTGATATA GTATCTGTAAACGTCCCACTGAACCACAATACTCACCATCTAATCAATGCAGAGACTATT GAAAAAATGAAAGATGGTGTAGTTATTGTTAACACAGCGCGTGGTGCCGTGATAGACGAA CAAGCCATGACTGATGCTTTGCGTTCTGGAAAGATTAGAAGTGCTGGTTTGGACGTTTTC GAATATGAGCCAAAAATATCCAAAGAGTTATTATCGATGTCCCAAGTCTTAGGACTGCCT CATATGGGCACACATAGTGTAGAAACAAGAAAGAAAATGGAAGAACTGGTCGTTGAAAAT GCAAAGAATGTGATATTGACCGGGAAAGTCTTGACTATTGTTCCGGAATTACAAAATGAA GACTGGCCCAATGAATCTAAGCCATTAGTTTGA
Protein Properties
Pfam Domain Function
Protein Residues350
Protein Molecular Weight38831.19922
Protein Theoretical pI6.3
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative 2-hydroxyacid dehydrogenase YNL274C MSKKPIVLKLGKDAFGDQAWGELEKIADVITIPESTTREQFLREVKDPQNKLSQVQVITR TARSVKNTGRFDEELALALPSSVVAVCHTGAGYDQIDVEPFKKRHIQVANVPDLVSNATA DTHVFLLLGALRNFGIGNRRLIEGNWPEAGPACGSPFGYDPEGKTVGILGLGRIGRCILE RLKPFGFENFIYHNRHQLPSEEEHGCEYVGFEEFLKRSDIVSVNVPLNHNTHHLINAETI EKMKDGVVIVNTARGAVIDEQAMTDALRSGKIRSAGLDVFEYEPKISKELLSMSQVLGLP HMGTHSVETRKKMEELVVENAKNVILTGKVLTIVPELQNEDWPNESKPLV
References
External Links
ResourceLink
Saccharomyces Genome Database YNL274C
Uniprot IDP53839
Uniprot NameYN14_YEAST
GenBank Gene IDAY692660
Genebank Protein ID51012771
General Reference
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Rintala, E., Pitkanen, J. P., Vehkomaki, M. L., Penttila, M., Ruohonen, L. (2007). "The ORF YNL274c (GOR1) codes for glyoxylate reductase in Saccharomyces cerevisiae." Yeast 24:129-136.17173333