You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameEndo-1,3(4)-beta-glucanase 1
Synonyms
  • Endo-1,3-beta-glucanase 1
  • Endo-1,4-beta-glucanase 1
  • Daughter specific expression protein 4
  • Laminarinase-1
Gene NameDSE4
Enzyme Class
Biological Properties
General FunctionInvolved in endo-1,3(4)-beta-glucanase activity
Specific FunctionInvolved in the dissoultion of the mother-daughter septum during cell separation
Cellular LocationSecreted, cell wall.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
water + (1->3)-beta-D-glucan D-Glucose
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
endo-1,3(4)-beta-glucanase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
Process
catabolic process
cell wall macromolecule catabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNR067C
Gene Sequence>3354 bp ATGCAATTATATCTGACACTTCTTTTTCTATTAAGTTTCGTCGAATGTTCATATATAAGT TTCATATCGAATAATGCAGACGAAATATTGGAAACTGATTTAATTGAAACTTTATCTTAC GCTACTTTGACAGTAGGTGAGCCTTATGTTGCACAATCGGTGGTTGTAACAAGAGTATCT GCAGCTTCTCATAGCCCTCTCTCAGTTTCGCCAAAAAATAGAGTGAGCGCATCTCCAATT AATTCACAAGACAGTGATTCTAATACAAGAACAGCAGTTCAACTGTCATTGTCGTTATCA AACTACGCAAGCCAAGTATCTCAAAAAATAAGCGCACAAACCAATAATGATCCTGTCACT GTTTCAAATATTTACGCAAATGATAATTCGAAAAGCAAAAGTTCAGTACACAATTTGAGT TCGGTTTCCGGCGTCGCCTCAGTCATGCCAAGTGCATCAACAATGCGTAAAGTCACCACA TTATTATCTCAAACTGCTTCGACTTCGACTTCGACTTTATTTTCTTCATCTTTATCTATT TCGGGGACACAATTAAATGGAACTTTATTGACTTCTGTTTCAAAAGGTACAATCGATCCA CTGGTAACTCAAATGCCTTCCTATTCTTCCCAAGAAACAAAAATTATTCCTTCTTCATTG ACCTCGAATAAAACGATATATACTATTTCAGTAAGGACAAATGCAGCTACAGCTACCGGC GAAGATTCCTTCATTGCTTCAACTCCTGCTTCCTCGACTTTGTTCTATCCATCCAACTCA ACCCAGGATTTAGTCCAGACGCTCGCATCTACAACAGCAAGCCCTGCTTACCCATCTAAT AGGACACAAATCACTCTTTCTCCATCTGTATCACTATATTCGACAACTAGTCCAATTTAC CCTTCAAACATTACAGAAAACGGTTCTTCACCATCACCATCACTATCATCGACTGTTAGT CCAGTTTATCCATCGAGTTCAACAGGAAACATTCTTTTGTCATCACTATTTTCAACAGTA GATTCTTCTTCCTCTCCGGTTTCTTCGACATTAGATACCATTTATGTATCTTCTTCAATG CAAGCTACCATCTCTTCGTCCTCATCTTCGAGACAAACAAAAACTTCCTCCTCTTCTCTG TCAACCTCGACCAGTAGCACCGCTACCACAACGGAGAACTCTTCAACAACGACCATTGTC AATCTTTTCAATGCTGTTTCGACAGATGAACCACCAACTGTTTTTGACAGATCACCAAAT CCTATGTCATTGGCTGATGGGGTGTCAAACGATGGTCCCATTCAAACAAACAAGTTTTAT ACAAATTTGATTGTTGGTAGTCAGGAATCACCTGCCTTTGTGTATCCTTATTCATTGTGG AAGTACACCTCGAGTTCATATGGTTTTGCTGTTCAACATACAACAGTAGATCAATATAGC TACGGTGGTTATGACAGTTCCGGTAATGCAGAATATTTGGTCAATCCTTTGGGAATTGCT CATGTTGTTTTCTCAGCTTCGAATTTTGATTCAAGTATGACTATGCAAGTTGATGAAATG ACCTTGTCTTCAACAAGGGTAGTGCTATCAGAATCCAATGATTCTTCGAACTACCTGGAA ATACCTTTGGTTCAAGGTATGGGATTTGCAACTGGTATATATCATGGATCTTTAAATGCC AAGATTGGTTCCAGCGTCGGATTCAATACCATTGTTTCTGAATCATCAAGCAATTTAGCT CAGGGTATTCTCAAATATCGTATCACCCTTTTGAATGGAGTCACTTGGTTATGTTACGTG ATAGGACCAGACGATTTAACCTCAACGGACTTTTCATTGGAGGTGAGCTCAGAATATGAA ATTAAAGCAAGCGCTAGTGTTGATGGTCTTATCATTCAATTGGCCGTCGCACCTTCTGAA ACTGATTACGAGGTCTTTTATGATCAAGCCGCAGGTATGTACGTTACTAATTTCAAGCTG CAGGGTGTCTCTGACGGTTCTACAGCTACCTATGAATTTTCTTATACCACCCAAGGTGAG TCGGCATCAGGTAGCACAATGATTTTTGCCTTGCCCCATCATGAATCTTCATTTAGTGAT ATAATGCAAGACTACTATACCGGCATTCAACTCGCTTCTACAACTAAGGGTGTAATGAAC GGTTATCTAACAACGAGCCTACAATTTTCCACATCTCTAAACAGACAAATATCTTGGTTA CCATGGTCTTCTCAACTTGGCTCAAACCTTTTAGAGTATTCTAAAGAACAATTGCAATTA TTAGCTGAAGTTGCCAATTCCGAATTACAGGTTAGTATTTCCGAAAGTATAAGCGGGTTA AACACATATTATTTGGGTAAAGTTATCGATAAGTATTCTTACATTCTATTAACGGTCTCC GAAATCATCCAAGATGAAGCCAGTACTAAGAGTACTTTGGAAAACATCAAATCGGCCTTT GATATTCTGCTACAAAATGAACAGACGTATCCACTAATTTACGACACAAAGTTCAACGGT TTGGTCAGTTCAGGAGATTGGGGTTCCACCAGCACGCAATACGATTTTGGTAACACTTAT TACAATGACCATCATTTCCATTATGGTTACATTATTCATGCAGCTGCTGTCATCGGCTAT GTTGACTCTAAACTGAATGGTACTTGGGCTGCCGACAATAAAGATTGGGTCAATTCATTG GTAAGAGATGTCGCAAATCCATCTGAAAAAGATGAATACTTTGCACAATCGAGAATGTTT GATTGGTTCAACGGTCATTCATGGGCAGCTGGACTTTATGAAAACGGTAACGGTAAGAAC GAAGAAAGTAGTAGTGAAGATTACAATTTTGCCTATGCTATGAAGTTATGGGGGGCCACT ATCGGTGACCAGTCAATGGAATTGAGGGGTGACTTGATGATTAGTATAATGAAGGATGCA ATGAACGACTATTTCTATTATCAAAATGACAACACAGTTGAGCCTGAAGAAATCATAGGA AATAAAGTGAGTGGTATTTTATTCGATAATATTATCGATTATACTACTTATTTTGGAACA AACACAGAATATATCCACGGTATTCATATGCTACCTATCACACCAGTTTCTTCTAATATT CGTTCTGAGACTTTCGTCGAAGAAGAATGGCAGACTAAAATCGAGCCAATTATTGAATCG ATAGAAAGCGGCTGGACAGGCATATTGAAGCTGAATCAAGCACTCTTCGACCCAGTAGAT TCGTATGCATTTTTCAGTGATTCAACTTTTGATTCATCCACATATTTGGATAACGGAATG AGTCGCACATGGGCATTAGCATTTTCAGGGGGACTGGCCAACTCAATTGCTTAG
Protein Properties
Pfam Domain Function
Protein Residues1117
Protein Molecular Weight121063.0
Protein Theoretical pI4.13
Signalling Regions
  • 1-16
Transmembrane Regions
  • None
Protein Sequence>Endo-1,3(4)-beta-glucanase 1 MQLYLTLLFLLSFVECSYISFISNNADEILETDLIETLSYATLTVGEPYVAQSVVVTRVS AASHSPLSVSPKNRVSASPINSQDSDSNTRTAVQLSLSLSNYASQVSQKISAQTNNDPVT VSNIYANDNSKSKSSVHNLSSVSGVASVMPSASTMRKVTTLLSQTASTSTSTLFSSSLSI SGTQLNGTLLTSVSKGTIDPLVTQMPSYSSQETKIIPSSLTSNKTIYTISVRTNAATATG EDSFIASTPASSTLFYPSNSTQDLVQTLASTTASPAYPSNRTQITLSPSVSLYSTTSPIY PSNITENGSSPSPSLSSTVSPVYPSSSTGNILLSSLFSTVDSSSSPVSSTLDTIYVSSSM QATISSSSSSRQTKTSSSSLSTSTSSTATTTENSSTTTIVNLFNAVSTDEPPTVFDRSPN PMSLADGVSNDGPIQTNKFYTNLIVGSQESPAFVYPYSLWKYTSSSYGFAVQHTTVDQYS YGGYDSSGNAEYLVNPLGIAHVVFSASNFDSSMTMQVDEMTLSSTRVVLSESNDSSNYLE IPLVQGMGFATGIYHGSLNAKIGSSVGFNTIVSESSSNLAQGILKYRITLLNGVTWLCYV IGPDDLTSTDFSLEVSSEYEIKASASVDGLIIQLAVAPSETDYEVFYDQAAGMYVTNFKL QGVSDGSTATYEFSYTTQGESASGSTMIFALPHHESSFSDIMQDYYTGIQLASTTKGVMN GYLTTSLQFSTSLNRQISWLPWSSQLGSNLLEYSKEQLQLLAEVANSELQVSISESISGL NTYYLGKVIDKYSYILLTVSEIIQDEASTKSTLENIKSAFDILLQNEQTYPLIYDTKFNG LVSSGDWGSTSTQYDFGNTYYNDHHFHYGYIIHAAAVIGYVDSKLNGTWAADNKDWVNSL VRDVANPSEKDEYFAQSRMFDWFNGHSWAAGLYENGNGKNEESSSEDYNFAYAMKLWGAT IGDQSMELRGDLMISIMKDAMNDYFYYQNDNTVEPEEIIGNKVSGILFDNIIDYTTYFGT NTEYIHGIHMLPITPVSSNIRSETFVEEEWQTKIEPIIESIESGWTGILKLNQALFDPVD SYAFFSDSTFDSSTYLDNGMSRTWALAFSGGLANSIA
References
External Links
ResourceLink
Saccharomyces Genome Database DSE4
Uniprot IDP53753
Uniprot NameENG1_YEAST
GenBank Gene IDZ71682
Genebank Protein ID1302598
General Reference
  • Baladron, V., Ufano, S., Duenas, E., Martin-Cuadrado, A. B., del Rey, F., Vazquez de Aldana, C. R. (2002). "Eng1p, an endo-1,3-beta-glucanase localized at the daughter side of the septum, is involved in cell separation in Saccharomyces cerevisiae." Eukaryot Cell 1:774-786.12455695
  • Mrsa, V., Klebl, F., Tanner, W. (1993). "Purification and characterization of the Saccharomyces cerevisiae BGL2 gene product, a cell wall endo-beta-1,3-glucanase." J Bacteriol 175:2102-2106.8458852
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Cappellaro, C., Mrsa, V., Tanner, W. (1998). "New potential cell wall glucanases of Saccharomyces cerevisiae and their involvement in mating." J Bacteriol 180:5030-5037.9748433
  • Martin-Cuadrado, A. B., Fontaine, T., Esteban, P. F., del Dedo, J. E., de Medina-Redondo, M., del Rey, F., Latge, J. P., de Aldana, C. R. (2008). "Characterization of the endo-beta-1,3-glucanase activity of S. cerevisiae Eng2 and other members of the GH81 family." Fungal Genet Biol 45:542-553.17933563