You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name7-keto 8-aminopelargonic acid transporter
Synonyms
  • KAPA transporter
Gene NameBIO5
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in amino acid transmembrane transporter activity
Specific FunctionTransport into the cell of 7-keto 8-aminopelargonic acid
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB Pathways
Biotin BiosynthesisPW002380 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00862hydronShow
YMDB009058-Amino-7-oxononanoic acidShow
GO Classification
Component
cell part
membrane
Function
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 14
LocusYNR056C
Gene Sequence>1686 bp ATGAACAGAGTAGGGGCAGTGTTCCTATTTGTATATGAAAGAAATTTTTTTTTGTCTATT GTTCCAGATCGTCACAGGACGGAAATAAGAATGTCTAGTTCAGAAAGGTCAGAAGTCAAG TTTGACAAGCACTTTAATTGGTGGTCCCTATTAGGTATCGCGTTCTCATTAAGTTGCTCA TGGGTCGGTATCTCAGCGTCGATGGCCGTTGGTATTGCCAGTGGAGGGCCACTGCTTATC ATCTATGGGTTGATAATTGCTGCTTTTTTCAGTCTCATGTGTGGTATATCTCTGGGAGAT TTTGCTGCTATCCTGCCAAACAGCAGCGGTGGTTCATTTTGGGTTCTTAAAATGTTGGAA CAAGAATCAGTCACTTTGAAAACCCCTGAGTACGAGGACCCTTCTGACGATGATGAAGAA GTGTTCCTCGAGAATTATTGTCAAACTTTCAACGTGGAAGTTTCTTCTAAATTTCAAAAG GTTTCTTCCATGGTTGTAGGGTTGCTGAACTATTTCGGTGCCATTTTTACTACCGCAAGT ATCTGCTCATCTTTGTCAATGAGCTGTATCGGTATTCATAAGTTGTTGCATCCGGACTAC GAGTTAAAGCACTGGCATGTTTTTGTGGGTTACGAGTGTATCAATGCCGTTTTGACACTT TTCAACATTTATTCAACTCCGTTGCCCTATATCTCTCAGTTTGGGCTCTATACGTCTCTA TTGTCTTTCGCCATGACTTTCATTATTTGTATTGTTTCAAGATCTGACAACACCGTAGAC CCATGGCCCAAAGCTTCTAATATATTTGGGAGCTTTGATAATCAAACAGGCTGGAATTCG TCTGGAATGGCGTTTGTTGTCGGTTTGGTCAATCCGATCTGGGCATTTGTTGGCATTGAC TCTGCTACGCACATGATTGATGAAGTGGGTTATAGTAAGTCACGTTTCTTAGTTCCCAAA GTTATTATCACTACCATCATTGTGGGCTTTGTAACTAGTTTTATTTATTGCGTTGGTTTG TTTTTCTGCATCACTGACCAAACGGCAGTCGTTGAGTCTATTTTACCTATCGTAGAAATA TTTTACCAGGCCACTGGTAATAGGAATCTCAGTGTCTTCCTGCAATGTATGTGTATCACA ACAGGTTTTGTTTCAGGCATTGCAAGTGGAACCTGGCAAAGTCGAATCCTCCAATCATTC GGGAAAAGTTACGCACCATTTTATAAAGAGGGTTCCTTGGGAAACAAATCCTTGAAGAAG CTAGCAGTGTTGACACCTGGGTTTAAGTCTCCATTATATGCCCATTTTTTGTCACAAATA TGTGTAACGATAATTGGCTGTATATTTATGGGATCTAGTACCGCTTTCAACGCAATTATC ACTGCATGCATCACCCTGTTACTAATGTCGTACGCAGTTCCTTCTTTTATATTCCTGTTC GTTATTAAAAAGGAAAAATTCATTCATAGAATCGAGAGTGACGTAAATTGTGTCAGCAGG CCTAACCGTCGTCGTATGTCTATGATTCCTCATATTATATGTATTCTATGGACCTTGTTC TGCCTGGTATTTTTATCTTTCCCATATACACTACCGGTTACTGCAGGAAACATGAATTAC ACCTCAGTAGTGTATGCAGTAGTTTTCTGCATTATCAGCATCGTTGTTTTCCCTACATGC ATCTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues561
Protein Molecular Weight62427.5
Protein Theoretical pI7.33
Signalling Regions
  • None
Transmembrane Regions
  • 50-70
  • 78-98
  • 161-181
  • 205-225
  • 231-251
  • 282-302
  • 322-342
  • 370-390
  • 440-460
  • 462-482
  • 508-528
  • 541-560
Protein Sequence>7-keto 8-aminopelargonic acid transporter MNRVGAVFLFVYERNFFLSIVPDRHRTEIRMSSSERSEVKFDKHFNWWSLLGIAFSLSCS WVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCGISLGDFAAILPNSSGGSFWVLKMLE QESVTLKTPEYEDPSDDDEEVFLENYCQTFNVEVSSKFQKVSSMVVGLLNYFGAIFTTAS ICSSLSMSCIGIHKLLHPDYELKHWHVFVGYECINAVLTLFNIYSTPLPYISQFGLYTSL LSFAMTFIICIVSRSDNTVDPWPKASNIFGSFDNQTGWNSSGMAFVVGLVNPIWAFVGID SATHMIDEVGYSKSRFLVPKVIITTIIVGFVTSFIYCVGLFFCITDQTAVVESILPIVEI FYQATGNRNLSVFLQCMCITTGFVSGIASGTWQSRILQSFGKSYAPFYKEGSLGNKSLKK LAVLTPGFKSPLYAHFLSQICVTIIGCIFMGSSTAFNAIITACITLLLMSYAVPSFIFLF VIKKEKFIHRIESDVNCVSRPNRRRMSMIPHIICILWTLFCLVFLSFPYTLPVTAGNMNY TSVVYAVVFCIISIVVFPTCI
References
External Links
ResourceLink
Saccharomyces Genome Database BIO5
Uniprot IDP53744
Uniprot NameBIO5_YEAST
GenBank Gene IDU90440
Genebank Protein ID1899253
General Reference
  • Phalip, V., Kuhn, I., Lemoine, Y., Jeltsch, J. M. (1999). "Characterization of the biotin biosynthesis pathway in Saccharomyces cerevisiae and evidence for a cluster containing BIO5, a novel gene involved in vitamer uptake." Gene 232:43-51.10333520
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258