You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphogluconate dehydrogenase, decarboxylating 2
SynonymsNot Available
Gene NameGND2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the oxidative decarboxylation of 6- phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH
Cellular LocationNot Available
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
Pentose phosphate pathwayec00030 Map00030
SMPDB ReactionsNot Available
KEGG Reactions
6-Phosphogluconic acid + NADPCarbon dioxide + NADPH + D-ribulose 5-phosphate
Metabolites
YMDB IDNameView
YMDB002186-Phosphogluconic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00912Carbon dioxideShow
YMDB00948D-ribulose 5-phosphateShow
GO Classification
Component
Not Available
Function
nucleotide binding
coenzyme binding
oxidoreductase activity
phosphogluconate dehydrogenase (decarboxylating) activity
catalytic activity
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
binding
NADP or NADPH binding
Process
glucose metabolic process
oxidation reduction
glucose catabolic process
small molecule metabolic process
pentose-phosphate shunt
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR256W
Gene Sequence>1479 bp ATGTCAAAGGCAGTAGGTGATTTAGGCTTAGTTGGTTTAGCCGTGATGGGTCAAAATTTG ATCTTAAACGCAGCGGATCACGGATTTACCGTGGTTGCTTATAATAGGACGCAATCAAAG GTAGATAGGTTTCTAGCTAATGAGGCAAAAGGAAAATCAATAATTGGTGCAACTTCAATT GAGGACTTGGTTGCGAAACTAAAGAAACCTAGAAAGATTATGCTTTTAATCAAAGCCGGT GCTCCGGTCGACACTTTAATAAAGGAACTTGTACCACATCTTGATAAAGGCGACATTATT ATCGACGGTGGTAACTCACATTTCCCGGACACTAACAGACGCTACGAAGAGCTAACAAAG CAAGGAATTCTTTTTGTGGGCTCTGGTGTCTCAGGCGGTGAAGATGGTGCACGTTTTGGT CCATCTTTAATGCCTGGTGGGTCAGCAGAAGCATGGCCGCACATCAAGAACATCTTTCAA TCTATTGCCGCCAAATCAAACGGTGAGCCATGCTGCGAATGGGTGGGGCCTGCCGGTTCT GGTCACTATGTGAAGATGGTACACAACGGTATCGAGTACGGTGATATGCAGTTGATTTGC GAGGCTTACGATATCATGAAACGAATTGGCCGGTTTACGGATAAAGAGATCAGTGAAGTA TTTGACAAGTGGAACACTGGAGTTTTGGATTCTTTCTTGATTGAAATCACGAGGGACATT TTAAAATTCGATGACGTCGACGGTAAGCCATTGGTGGAAAAAATTATGGATACTGCCGGT CAAAAGGGTACTGGTAAATGGACTGCAATCAACGCCTTGGATTTAGGAATGCCAGTCACT TTAATTGGGGAGGCTGTTTTCGCTCGTTGTTTGTCAGCCATAAAGGACGAACGTAAAAGA GCTTCGAAACTTCTGGCAGGACCAACAGTACCAAAGGATGCAATACATGATAGAGAACAA TTTGTGTATGATTTGGAACAAGCATTATACGCTTCAAAGATTATTTCATATGCTCAAGGT TTCATGCTGATCCGCGAAGCTGCCAGATCATACGGCTGGAAATTAAACAACCCAGCTATT GCTCTAATGTGGAGAGGTGGCTGTATAATCAGATCTGTGTTCTTAGCTGAGATTACGAAG GCTTATAGGGACGATCCAGATTTGGAAAATTTATTATTCAACGAGTTCTTCGCTTCTGCA GTTACTAAGGCCCAATCCGGTTGGAGAAGAACTATTGCCCTTGCTGCTACTTACGGTATT CCAACTCCAGCTTTCTCTACTGCTTTAGCGTTTTACGACGGCTATAGATCTGAGAGGCTA CCAGCAAACTTGTTACAAGCGCAACGTGATTATTTTGGCGCTCATACATTTAGAATTTTA CCTGAATGTGCTTCTGCCCATTTGCCAGTAGACAAGGATATTCATATCAATTGGACTGGG CACGGAGGTAATATATCTTCCTCAACCTACCAAGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues492
Protein Molecular Weight53922.30078
Protein Theoretical pI7.32
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphogluconate dehydrogenase, decarboxylating 2 MSKAVGDLGLVGLAVMGQNLILNAADHGFTVVAYNRTQSKVDRFLANEAKGKSIIGATSI EDLVAKLKKPRKIMLLIKAGAPVDTLIKELVPHLDKGDIIIDGGNSHFPDTNRRYEELTK QGILFVGSGVSGGEDGARFGPSLMPGGSAEAWPHIKNIFQSIAAKSNGEPCCEWVGPAGS GHYVKMVHNGIEYGDMQLICEAYDIMKRIGRFTDKEISEVFDKWNTGVLDSFLIEITRDI LKFDDVDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSAIKDERKR ASKLLAGPTVPKDAIHDREQFVYDLEQALYASKIISYAQGFMLIREAARSYGWKLNNPAI ALMWRGGCIIRSVFLAEITKAYRDDPDLENLLFNEFFASAVTKAQSGWRRTIALAATYGI PTPAFSTALAFYDGYRSERLPANLLQAQRDYFGAHTFRILPECASAHLPVDKDIHINWTG HGGNISSSTYQA
References
External Links
ResourceLink
Saccharomyces Genome Database GND2
Uniprot IDP53319
Uniprot Name6PGD2_YEAST
GenBank Gene IDAY692811
Genebank Protein ID51013073
General Reference
  • Mazzoni, C., Ruzzi, M., Rinaldi, T., Solinas, F., Montebove, F., Frontali, L. (1997). "Sequence analysis of a 10.5 kb DNA fragment from the yeast chromosome VII reveals the presence of three new open reading frames and of a tRNAThr gene." Yeast 13:369-372.9133741
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106