Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name2',3'-cyclic-nucleotide 3'-phosphodiesterase
Synonyms
  • CPDase
Gene NameCPD1
Enzyme Class
Biological Properties
General FunctionInvolved in cyclic-nucleotide phosphodiesterase activity
Specific FunctionInvolved in the metabolism of ADP-ribose 1',2'-cyclic phosphate which is produced as a consequence of tRNA splicing
Cellular LocationGolgi apparatus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
2',3'-cyclic AMP + water + hydronAdenosine 2'-phosphate
Metabolites
YMDB IDNameView
YMDB00564Adenosine 2'-phosphateShow
YMDB005652',3'-cyclic AMPShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
cell part
intracellular
Function
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
cyclic-nucleotide phosphodiesterase activity
catalytic activity
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR247W
Gene Sequence>720 bp ATGGCAATAGCATTATGGTATTGTCCACCACAAGGATCAGTTGCTTACGAGACATTACAG ATGCTTATATTTTCGTTTCAAACGTTGTTCCCAGATTCACCAGTTTTTGAACCTCATGTG ACGGTAACGTCCCATTTGGTGTGCAATAGTAAAGATGATGTCAACAAAATCTTGACCTCC TGTGTTGCTGCCATCCAATCGATAAGGTCACACCAAACAGCAAAGAAAGGACGTAAGGGA CAGGTATCCCATGCTGTTGCAGCTCCTTTGGTATCTTTCAATGGATGCAGTGTAGGTAAA CAATATTTCAAGAAAATTGTGCTCGAGTGTAACAAGAACAAAATACTTTATGGGGTCGCA CAAGTCATGAGAGAGATGTACGTAGAGATCGATCCTGAGACGCGAAGTAGCCGTGCCGCC ACTTGGGTGCACGAGGAATTCCATCCTCACGTCTCATTGCTTTATTCGGATATTCATCCG GTAAGTCAGGCGTCATTGCGAGTAGTTCAACAAAGAATTGAAGATGCTCTAGACGTGCAA CTAGTTCCAAGAGAGAAACGTAAGGGTTCCGGAAACGCTGATGGGTCCAATGAAGTGCAA ATGAGATGGGATTTTGACGTATCTTCATCGCTATCTTGGAATATCCCAGGAACGTTTAAA GTGGTCAACTGTGTGGGGCCCGTTCAAGAATGGGAGGTATTGGGACGGGTGGACGTTTAA
Protein Properties
Pfam Domain Function
Protein Residues239
Protein Molecular Weight26731.40039
Protein Theoretical pI7.53
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>2',3'-cyclic-nucleotide 3'-phosphodiesterase MAIALWYCPPQGSVAYETLQMLIFSFQTLFPDSPVFEPHVTVTSHLVCNSKDDVNKILTS CVAAIQSIRSHQTAKKGRKGQVSHAVAAPLVSFNGCSVGKQYFKKIVLECNKNKILYGVA QVMREMYVEIDPETRSSRAATWVHEEFHPHVSLLYSDIHPVSQASLRVVQQRIEDALDVQ LVPREKRKGSGNADGSNEVQMRWDFDVSSSLSWNIPGTFKVVNCVGPVQEWEVLGRVDV
References
External Links
ResourceLink
Saccharomyces Genome Database CPD1
Uniprot IDP53314
Uniprot NameCPD1_YEAST
GenBank Gene IDAY558381
Genebank Protein ID45270652
General Reference
  • Feroli, F., Carignani, G., Pavanello, A., Guerreiro, P., Azevedo, D., Rodrigues-Pousada, C., Melchioretto, P., Panzeri, L., Agostoni Carbone, M. L. (1997). "Analysis of a 17.9 kb region from Saccharomyces cerevisiae chromosome VII reveals the presence of eight open reading frames, including BRF1 (TFIIIB70) and GCN5 genes." Yeast 13:373-377.9133742
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Culver, G. M., Consaul, S. A., Tycowski, K. T., Filipowicz, W., Phizicky, E. M. (1994). "tRNA splicing in yeast and wheat germ. A cyclic phosphodiesterase implicated in the metabolism of ADP-ribose 1",2"-cyclic phosphate." J Biol Chem 269:24928-24934.7929175
  • Nasr, F., Filipowicz, W. (2000). "Characterization of the Saccharomyces cerevisiae cyclic nucleotide phosphodiesterase involved in the metabolism of ADP-ribose 1",2"-cyclic phosphate." Nucleic Acids Res 28:1676-1683.10734185
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106