You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative cysteine synthase
Synonyms
  • CSase
  • O-acetylserine (thiol)-lyase
  • OAS-TL
  • O-acetylserine sulfhydrylase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in cysteine biosynthetic process from serine
Specific FunctionO(3)-acetyl-L-serine + H(2)S = L-cysteine + acetate
Cellular LocationNot Available
SMPDB Pathways
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Selenocompound metabolismec00450 Map00450
Sulfur metabolismec00920 Map00920
SMPDB Reactions
Hydrogen sulfide + O-acetyl-L-serineL-Cysteine + Acetic acid + hydron
Hydrogen sulfide + O-acetyl-L-serineL-Cysteine + Acetic acid + hydron
L-Cysteinehydron + Hydrogen sulfide + 2-Aminoacrylic acid
L-Cysteinehydron + Hydrogen sulfide + 2-Aminoacrylic acid
KEGG Reactions
O-acetyl-L-serine + Hydrogen sulfideAcetic acid + hydron + L-Cysteine
Metabolites
YMDB IDNameView
YMDB00046L-CysteineShow
YMDB00056Acetic acidShow
YMDB00121SulfideShow
YMDB00652O-acetyl-L-serineShow
YMDB00653Hydrogen sulfideShow
YMDB00862hydronShow
YMDB161622-Aminoacrylic acidShow
GO Classification
Component
Not Available
Function
binding
cofactor binding
pyridoxal phosphate binding
catalytic activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
serine family amino acid metabolic process
L-serine metabolic process
cysteine biosynthetic process from serine
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYGR012W
Gene Sequence>1182 bp ATGTCCTGTTCTCAAAATAAGACTTCTGTCAGTCTGGCCTGGCGTGAATGCATATCCATC GCTTCCGTCCTAATTGGCGCGTATGCATCATACAAATACTATAAGCTGTTCAAAACACGC GATATTCCACGTCCAAAAGAAGGCGTTGAAGAACTCATAGGAAACACTCCTCTGGTTAAG ATCAGATCTCTTACCAAGGCTACTGGAGTTAACATTTACGCTAAGTTGGAGTTATGCAAC CCAGCAGGAAGTGCTAAGGATAGAGTGGCTTTAAACATCATAAAGACGGCTGAGGAATTA GGCGAGCTCGTCAGAGGTGAACCTGGCTGGGTATTTGAAGGAACAAGTGGGTCGACTGGT ATCTCTATAGCAGTGGTCTGTAATGCGTTGGGTTATAGGGCACACATTTCTTTGCCCGAT GACACATCGCTAGAAAAATTGGCATTACTAGAAAGCCTCGGTGCTACTGTTAATAAGGTT AAGCCCGCTAGTATTGTCGATCCAAACCAATACGTAAATGCCGCCAAAAAGGCATGTAAT GAACTAAAGAAGAGTGGTAATGGAATAAGAGCAGTTTTTGCCGATCAGTTCGAAAACGAA GCCAACTGGAAAGTACATTACCAGACCACAGGCCCAGAAATTGCCCATCAAACTAAGGGA AATATTGACGCATTCATTGCTGGCTGCGGTACTGGTGGCACCATAACTGGTGTGGCAAAA TTCTTAAAGGAAAGAGCAAAGATACCTTGCCATGTCGTTCTAGCGGATCCACAAGGATCT GGCTTTTATAATAGAGTCAACTATGGCGTGATGTATGACTATGTAGAGAAGGAAGGTACT AGAAGAAGGCATCAAGTTGACACTATCGTAGAAGGGATTGGGTTAAACAGAATCACTCAT AATTTTCATATGGGCGAAAAGTTTATTGATGAATCAATACGAGTCAACGATAATCAAGCC ATTAGAATGGCAAAATACCTATCGGTAAACGACGGGCTATTCGTGGGGAGTAGTACAGCT ATTAATGCGGTAGCCGCTATTCAGGTTGCAAAAACGCTTCCTCACGGCTCAAACATTGTG ATTATTGCATGCGACAGCGGTTCAAGACACCTAAGTAAATTCTGGAAAGAAGCTAAAGAA ATCGATCACGACGTGTCATTAGAAGAAGTAATAAATATCTAA
Protein Properties
Pfam Domain Function
Protein Residues393
Protein Molecular Weight42800.5
Protein Theoretical pI8.37
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative cysteine synthase MSCSQNKTSVSLAWRECISIASVLIGAYASYKYYKLFKTRDIPRPKEGVEELIGNTPLVK IRSLTKATGVNIYAKLELCNPAGSAKDRVALNIIKTAEELGELVRGEPGWVFEGTSGSTG ISIAVVCNALGYRAHISLPDDTSLEKLALLESLGATVNKVKPASIVDPNQYVNAAKKACN ELKKSGNGIRAVFADQFENEANWKVHYQTTGPEIAHQTKGNIDAFIAGCGTGGTITGVAK FLKERAKIPCHVVLADPQGSGFYNRVNYGVMYDYVEKEGTRRRHQVDTIVEGIGLNRITH NFHMGEKFIDESIRVNDNQAIRMAKYLSVNDGLFVGSSTAINAVAAIQVAKTLPHGSNIV IIACDSGSRHLSKFWKEAKEIDHDVSLEEVINI
References
External Links
ResourceLink
Saccharomyces Genome Database YGR012W
Uniprot IDP53206
Uniprot NameCYSK_YEAST
GenBank Gene IDZ72797
Genebank Protein ID1322974
General Reference
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106