You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADH pyrophosphatase
SynonymsNot Available
Gene NameNPY1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionNAD(+) + H(2)O = AMP + NMN
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
SMPDB ReactionsNot Available
KEGG Reactions
NAD + waterAdenosine monophosphate + Nicotinamide ribotide + hydron
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00110NADShow
YMDB00138Nicotinamide ribotideShow
YMDB00412NAD(+)Show
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
hydrolase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 7
LocusYGL067W
Gene Sequence>1155 bp ATGTCCACTGCTGTGACTTTTTTTGGCCAGCATGTCTTGAACAGAGTTTCGTTCTTAAGA TGTTCGAAAGAGTTCATCAAAAAATCATTGAACCATGACTCTACCGTTTTTATCCCATTT ATCGAAGGGGAAGCCCTCATTTCGCCCGAAAATGGTGACCTAGTTCAGCTTTCTAATTCT GTAAAGTCTTACAAGAATATTTTGTCAGCAATAGTTCCTTTATACACTACTTTATTGAAC ACAACTCGCTCAAGAAGCGATGAATCAGGCATCAATGTAACATTTTTAGGTCTCCTGGAA GGCACAGATTCTGCATTTAATTTTGAATGGTCTAATATTTCTTACAAAGGAACACCATAT TTTGGATTAGATATCCGTGTTACTGAGAGCACACTCTTCAAGAAAGTCGACTTTGAGCCT ATTTTTTCCTATCCGAAGGTGACCAGAGATCACATTTTCAAACAAACAAATGAGGATGCT TCACTTTATTCACAAGGTAAGATGTATCTGGATTGGCTAGCAAAGTACAAATTCTGTCCC GGTTGTGGGTCTCCGTTATTCCCAGTAGAGGCAGGAACTAAGCTTCAGTGTTCTAATGAA AATCGGAATGTATACTGTAATGTGAGAGATGCAAGAATTAATAACGTTTGCTTCCCAAGA ACTGATCCAACGGTCATTATAGCCTTGACCAATTCGGATTACTCTAAGTGTTGTCTGGCA AGATCAAAAAAAAGGTACGGTGATTTTGTATTGTATTCAACAATAGCAGGTTTTATGGAG CCATCAGAAACCATAGAGGAGGCTTGTATCAGAGAAATATGGGAGGAAACAGGCATTTCA TGCAAAAATATTGATATAGTCCGGTCACAGCCCTGGCCTTACCCTTGCAGTTTGATGATT GGCTGTTTAGGCATAGTTCAATTCAATTCCAAAAATGAGGTTATCAACCTGAATCATGAC GACGAATTATTGGATGCTCAATGGTTTGATACAACTGAAATCATTCAAGCTTTGGATAAG TACGCCGGCGGGTATCGTGTTCCATTCAAAAATGATATCAATTTACCTGGAAGTACTACC ATTGCCTTCCAATTAATCAATCATGTTTGCGAGAACTATAAAAACTTACGTAAGACCTCA TCGAGCCATCTATAG
Protein Properties
Pfam Domain Function
Protein Residues384
Protein Molecular Weight43516.0
Protein Theoretical pI6.25
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NADH pyrophosphatase MSTAVTFFGQHVLNRVSFLRCSKEFIKKSLNHDSTVFIPFIEGEALISPENGDLVQLSNS VKSYKNILSAIVPLYTTLLNTTRSRSDESGINVTFLGLLEGTDSAFNFEWSNISYKGTPY FGLDIRVTESTLFKKVDFEPIFSYPKVTRDHIFKQTNEDASLYSQGKMYLDWLAKYKFCP GCGSPLFPVEAGTKLQCSNENRNVYCNVRDARINNVCFPRTDPTVIIALTNSDYSKCCLA RSKKRYGDFVLYSTIAGFMEPSETIEEACIREIWEETGISCKNIDIVRSQPWPYPCSLMI GCLGIVQFNSKNEVINLNHDDELLDAQWFDTTEIIQALDKYAGGYRVPFKNDINLPGSTT IAFQLINHVCENYKNLRKTSSSHL
References
External Links
ResourceLink
Saccharomyces Genome Database NPY1
Uniprot IDP53164
Uniprot NameNPY1_YEAST
GenBank Gene IDZ72589
Genebank Protein ID1322576
General Reference
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Xu, W., Dunn, C. A., Bessman, M. J. (2000). "Cloning and characterization of the NADH pyrophosphatases from Caenorhabditis elegans and Saccharomyces cerevisiae, members of a Nudix hydrolase subfamily." Biochem Biophys Res Commun 273:753-758.10873676
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106