You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCystathionine beta-lyase
Synonyms
  • CBL
  • Beta-cystathionase
  • Cysteine lyase
  • Sulfur transfer protein 3
Gene NameSTR3
Enzyme Class
Biological Properties
General FunctionInvolved in pyridoxal phosphate binding
Specific FunctionL-cystathionine + H(2)O = L-homocysteine + NH(3) + pyruvate
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Cysteine MetabolismPW002383 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Nitrogen metabolismec00910 Map00910
Selenocompound metabolismec00450 Map00450
Sulfur metabolismec00920 Map00920
SMPDB Reactions
Homocysteine + Pyruvic acid + Ammoniumwater + L-Cystathionine
Selenocystathionine + waterSelenohomocysteine + Ammonia + Pyruvic acid
KEGG Reactions
L-Cystathionine + waterL-Homocysteine + Pyruvic acid + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00175Pyruvic acidShow
YMDB00245L-CystathionineShow
YMDB00371HomocysteineShow
YMDB00423AmmoniumShow
YMDB00520L-HomocysteineShow
YMDB00890waterShow
YMDB16178SelenohomocysteineShow
YMDB16184SelenocystathionineShow
GO Classification
Component
Not Available
Function
binding
cofactor binding
pyridoxal phosphate binding
carbon-sulfur lyase activity
catalytic activity
lyase activity
cystathionine beta-lyase activity
Process
'de novo' L-methionine biosynthetic process
cellular amino acid metabolic process
sulfur amino acid metabolic process
metabolic process
sulfur amino acid biosynthetic process
methionine biosynthetic process
L-methionine biosynthetic process
cellular metabolic process
cellular amino acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL184C
Gene Sequence>1398 bp ATGCCGATCAAGAGATTAGATACAGTTGTGGTAAATACCGGCTCTCAAAATGACCAACAT TCAGCCTCCGTGCCACCGGTGTATTTGTCGACTACCTTCAAAGTGGACTTGAATAATGAA GATGCACAGAACTACGATTATTCCAGATCGGGAAACCCGACCAGAAGTGTCCTTCAACAC CAGATTGGTAAGCTTTATCGTGTCCCACAGGAAAACGTATTAGCTGTGAGCAGTGGTATG ACGGCGCTAGACGTCATCCTGCGTGGGCTCGTCTTACTTAACGGCACTGACAACCATACG CCAACAATAATAGCCGGCGATGATCTTTATGGAGGCACCCAAAGGCTGCTGAATTTTTTC AAGCAACAGAGTCATGCAGTCTCTGTTCATGTGGACACTTCCGATTTTGAAAAGTTCAAA ACCGTTTTCCAGTCTTTAGATAAAGTTGATTGTGTTCTTCTAGAGTCTCCGACCAATCCG CTTTGCAAGGTTGTAGATATCCCTAGAATATTACGTTTTGTGAAATGCATATCTCCCGAC ACTACAGTTGTCGTTGATAATACTATGATGAGTGGACTCAATTGTAATCCTCTTCAACTG AATCCAGGCTGCGATGTCGTATACGAATCTGCTACCAAGTACTTGAATGGTCATCACGAT TTGATGGGGGGTGTTATTATCAGCAAAACACCAGAAATAGCCTCGAAGCTTTACTTTGTC ATTAATTCTACAGGAGCTGGATTATCCCCAATGGATTCTTGGCTACTTGTGAGGGGCCTA AAAACTCTAGGAGTTAGATTATATCAACAGCAGAGAAATGCTATGATATTGGCTCATTGG CTAGAAAATTCATGCGGATTCAAACCTACCAGAACAAACAAGGCTACGAAAACTAGATTT GTTGGATTACGCTCCAACCCGGATTTCAAGCTGCATAAATCGTTCAATAATGGCCCAGGT GCCGTGTTATCCTTCGAAACGGGGTCCTTCGAACATTCAAAGAGACTGGTCAGTTCCAAA AAACTGAGTATATGGGCTGTGACGGTATCTTTCGGGTGTGTAAATTCGCTTCTATCTATG CCTTGCAAAATGTCCCATGCTTCCATTGATCCCGAATTAAGGAAAGAGAGAGATTTTCCT GAAGATTTGGTTCGTCTTTGCTGCGGTATCGAAAATATAGTAGATTTGAAGAAAGATTTA TTAGCGGCGATGGTTGACGCTGATATTATAGAAGTAAGAGAAAATGGCAAATATCTTTTC AACAAATTGAATAAGAACCTAGCTGTGAACACTACCATCGATGACCTGCATAAGCCTTTA AGTATTTACGAAGAATTTTACAATCAAGATCTCATCAGAAAGGACTCAGAATTGAATATT AAGAGTTCGAAATTGTAA
Protein Properties
Pfam Domain Function
Protein Residues465
Protein Molecular Weight51828.0
Protein Theoretical pI8.1
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cystathionine beta-lyase MPIKRLDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNNEDAQNYDYSRSGNPTRSVLQH QIGKLYRVPQENVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYGGTQRLLNFF KQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFVKCISPD TTVVVDNTMMSGLNCNPLQLNPGCDVVYESATKYLNGHHDLMGGVIISKTPEIASKLYFV INSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKPTRTNKATKTRF VGLRSNPDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFGCVNSLLSM PCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAMVDADIIEVRENGKYLF NKLNKNLAVNTTIDDLHKPLSIYEEFYNQDLIRKDSELNIKSSKL
References
External Links
ResourceLink
Saccharomyces Genome Database STR3
Uniprot IDP53101
Uniprot NameSTR3_YEAST
GenBank Gene IDX91489
Genebank Protein ID1143563
General Reference
  • Coglievina, M., Klima, R., Bertani, I., Delneri, D., Zaccaria, P., Bruschi, C. V. (1997). "Sequencing of a 40.5 kb fragment located on the left arm of chromosome VII from Saccharomyces cerevisiae." Yeast 13:55-64.9046087
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hansen, J., Johannesen, P. F. (2000). "Cysteine is essential for transcriptional regulation of the sulfur assimilation genes in Saccharomyces cerevisiae." Mol Gen Genet 263:535-542.10821189
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095