You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameC-4 methylsterol oxidase
Synonyms
  • Methylsterol monooxygenase
Gene NameERG25
Enzyme Class
Biological Properties
General FunctionInvolved in iron ion binding
Specific FunctionCatalyzes the first step in the removal of the two C-4 methyl groups of 4,4-dimethylzymosterol
Cellular LocationEndoplasmic reticulum membrane; Single-pass membrane protein (Probable)
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(12:0)PW002548 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(16:0)PW002550 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
4,4-Dimethyl-5a-cholesta-8,24-dien-3-b-ol + hydron + oxygen + NADPH4alpha-methylzymosterol + water + NADP
4,4-Dimethyl-5a-cholesta-8,24-dien-3-b-ol + hydron + oxygen + NADPH4α-hydroxymethyl-4β-methyl-5α-cholesta-8,24-dien-3β-ol + NADP + water
4α-hydroxymethyl-4β-methyl-5α-cholesta-8,24-dien-3β-ol + hydron + oxygen + NADPH4α-formyl-4β-methyl-5α-cholesta-8,24-dien-3β-ol + water + NADP
4α-formyl-4β-methyl-5α-cholesta-8,24-dien-3β-ol + oxygen + NADPH4β-methyl-4α-carboxy-cholesta-8,24-dien-3β-ol + water + NADP
4alpha-methylzymosterol + hydron + oxygen + NADPHwater + NADP + 4α-hydroxymethyl-5α-cholesta-8,24-dien-3β-ol
KEGG Reactions
4alpha-methylzymosterol + NADPH + hydron + oxygenNADP + zymosterol intermediate 1a + water
zymosterol intermediate 1a + NADPH + hydron + oxygenwater + zymosterol intermediate 1b + NADP
zymosterol intermediate 1b + NADPH + hydron + oxygenNADP + zymosterol intermediate 1c + water
oxygen + 4,4-Dimethyl-5a-cholesta-8,24-dien-3-b-ol + hydron + NADPH4beta-methylzymosterol-4alpha-carboxylic acid + NADP + water
Metabolites
YMDB IDNameView
YMDB001823-beta-Hydroxy-4-beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylateShow
YMDB002904,4-Dimethyl-5a-cholesta-8,24-dien-3-b-olShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB0060414-demethyllanosterolShow
YMDB00607zymosterol intermediate 1cShow
YMDB006104beta-methylzymosterol-4alpha-carboxylic acidShow
YMDB006114alpha-methylzymosterolShow
YMDB00612zymosterol intermediate 1aShow
YMDB00613zymosterol intermediate 1bShow
YMDB007954,4-dimethyl-5alpha-cholest-7-en-3beta-olShow
YMDB008193beta-hydroxy-4beta-methyl-5alpha-cholest-7-ene-4alpha-carboxylic acidShow
YMDB00862hydronShow
YMDB008703beta-hydroxy-4beta-methyl-5alpha-cholest-7-ene-4alpha-carbaldehydeShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB009724beta-(hydroxymethyl)-4alpha-methyl-5alpha-cholest-7-en-3beta-olShow
YMDB163154α-hydroxymethyl-4β-methyl-5α-cholesta-8,24-dien-3β-olShow
YMDB163164α-formyl-4β-methyl-5α-cholesta-8,24-dien-3β-olShow
YMDB163174β-methyl-4α-carboxy-cholesta-8,24-dien-3β-olShow
YMDB163184α-hydroxymethyl-5α-cholesta-8,24-dien-3β-olShow
YMDB163194α-formyl-5α-cholesta-8,24-dien-3β-olShow
YMDB163204α-carboxy-5α-cholesta-8,24-dien-3β-olShow
GO Classification
Component
endoplasmic reticulum
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
Function
ion binding
cation binding
metal ion binding
transition metal ion binding
iron ion binding
oxidoreductase activity
catalytic activity
binding
Process
oxidation reduction
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
metabolic process
monocarboxylic acid metabolic process
cellular metabolic process
fatty acid metabolic process
fatty acid biosynthetic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR060W
Gene Sequence>930 bp ATGTCTGCCGTTTTCAACAACGCTACCCTTTCAGGTCTAGTCCAAGCAAGCACCTACTCA CAAACTTTGCAAAATGTCGCCCATTACCAACCTCAATTGAATTTCATGGAAAAATACTGG GCCGCATGGTACAGTTACATGAACAATGATGTTTTGGCCACCGGTCTAATGTTCTTTTTA TTGCATGAATTTATGTATTTCTTTAGATGTTTGCCATGGTTCATCATCGACCAAATTCCA TACTTTAGAAGATGGAAGTTACAACCAACTAAGATTCCAAGTGCTAAGGAACAACTATAC TGTTTGAAATCCGTTCTTCTATCTCATTTCTTGGTCGAGGCCATCCCTATCTGGACCTTC CACCCAATGTGTGAAAAATTAGGTATTACTGTCGAAGTTCCATTCCCATCTTTGAAAACA ATGGCTCTAGAAATTGGTCTATTCTTCGTCTTGGAAGATACATGGCATTACTGGGCTCAC CGTCTATTCCACTACGGTGTCTTCTACAAGTACATTCACAAGCAACATCACAGATACGCT GCTCCATTCGGTCTTTCTGCTGAATATGCTCATCCTGCTGAGACTTTGTCTTTGGGTTTT GGTACCGTTGGTATGCCAATTCTTTACGTCATGTACACTGGTAAATTACATTTGTTCACT CTATGTGTATGGATCACCCTAAGATTATTCCAAGCTGTTGACTCTCATTCTGGTTATGAC TTCCCATGGTCCTTGAACAAGATCATGCCATTCTGGGCTGGCGCTGAACACCACGATTTG CATCATCACTACTTCATTGGTAACTACGCTTCCTCTTTCAGATGGTGGGATTACTGTCTA GACACTGAATCTGGTCCAGAAGCTAAGGCCTCCAGAGAAGAAAGAATGAAGAAGAGAGCT GAAAACAATGCTCAAAAGAAGACTAACTAA
Protein Properties
Pfam Domain Function
Protein Residues309
Protein Molecular Weight36478.89844
Protein Theoretical pI8.22
Signalling Regions
  • None
Transmembrane Regions
  • 56-76
Protein Sequence>C-4 methylsterol oxidase MSAVFNNATLSGLVQASTYSQTLQNVAHYQPQLNFMEKYWAAWYSYMNNDVLATGLMFFL LHEFMYFFRCLPWFIIDQIPYFRRWKLQPTKIPSAKEQLYCLKSVLLSHFLVEAIPIWTF HPMCEKLGITVEVPFPSLKTMALEIGLFFVLEDTWHYWAHRLFHYGVFYKYIHKQHHRYA APFGLSAEYAHPAETLSLGFGTVGMPILYVMYTGKLHLFTLCVWITLRLFQAVDSHSGYD FPWSLNKIMPFWAGAEHHDLHHHYFIGNYASSFRWWDYCLDTESGPEAKASREERMKKRA ENNAQKKTN
References
External Links
ResourceLink
Saccharomyces Genome Database ERG25
Uniprot IDP53045
Uniprot NameERG25_YEAST
GenBank Gene IDDQ115391
Genebank Protein ID71064046
General Reference
  • Bard, M., Bruner, D. A., Pierson, C. A., Lees, N. D., Biermann, B., Frye, L., Koegel, C., Barbuch, R. (1996). "Cloning and characterization of ERG25, the Saccharomyces cerevisiae gene encoding C-4 sterol methyl oxidase." Proc Natl Acad Sci U S A 93:186-190.8552601
  • Li, L., Kaplan, J. (1996). "Characterization of yeast methyl sterol oxidase (ERG25) and identification of a human homologue." J Biol Chem 271:16927-16933.8663358
  • Deutschbauer, A. M., Davis, R. W. (2005). "Quantitative trait loci mapped to single-nucleotide resolution in yeast." Nat Genet 37:1333-1340.16273108
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Mo, C., Valachovic, M., Randall, S. K., Nickels, J. T., Bard, M. (2002). "Protein-protein interactions among C-4 demethylation enzymes involved in yeast sterol biosynthesis." Proc Natl Acad Sci U S A 99:9739-9744.12119386
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hitchcock, A. L., Auld, K., Gygi, S. P., Silver, P. A. (2003). "A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery." Proc Natl Acad Sci U S A 100:12735-12740.14557538
  • Mo, C., Bard, M. (2005). "Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex." J Lipid Res 46:1991-1998.15995173
  • Natter, K., Leitner, P., Faschinger, A., Wolinski, H., McCraith, S., Fields, S., Kohlwein, S. D. (2005). "The spatial organization of lipid synthesis in the yeast Saccharomyces cerevisiae derived from large scale green fluorescent protein tagging and high resolution microscopy." Mol Cell Proteomics 4:662-672.15716577