You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable alanine aminotransferase, mitochondrial
Synonyms
  • Glutamate pyruvate transaminase
  • GPT
  • Glutamic--alanine transaminase
  • Glutamic--pyruvic transaminase
Gene NameALT1
Enzyme Class
Biological Properties
General FunctionInvolved in 1-aminocyclopropane-1-carboxylate synthase activity
Specific FunctionL-alanine + 2-oxoglutarate = pyruvate + L- glutamate
Cellular LocationMitochondrion matrix
SMPDB Pathways
L-alanine metabolismPW002373 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
SMPDB Reactions
L-Alanine + Oxoglutaric acidPyruvic acid + L-Glutamic acid
KEGG Reactions
Oxoglutaric acid + L-AlaninePyruvic acid + L-Glutamic acid
Metabolites
YMDB IDNameView
YMDB00153Oxoglutaric acidShow
YMDB00154L-AlanineShow
YMDB00175Pyruvic acidShow
YMDB00271L-Glutamic acidShow
GO Classification
Component
Not Available
Function
carbon-sulfur lyase activity
1-aminocyclopropane-1-carboxylate synthase activity
catalytic activity
transferase activity
lyase activity
binding
transferase activity, transferring nitrogenous groups
cofactor binding
pyridoxal phosphate binding
Process
metabolic process
biosynthetic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR089C
Gene Sequence>1779 bp ATGTTATCACTGTCTGCCAAAAATCACTTCACAGTGAGTAATTCTATAACTCACGTTATT AAGTCATATCATATAAGGACTCTCACTTCAAGCGCAGAAAAAATGCCACATATCACTACT CCTTTTTCTACCTCAGCCAGTAGTACAAAGTTAAAAGCTTTCAGGAAAGTTAGACCCGTC CTACAGAGACATAGCTCTTCCTGGATTGTTGCTCAAAATCATAGACGTTCATTATCTGGT CAATCTTCGCTAAACGACCTGCGTCATTTGAATCGCTTTCCACACCACACGTTGAAAACT TCGAATAACGAGTTTTATCCCGCCGAACAATTGACTTTGGAAGACGTAAATGAAAATGTC TTGAAGGCTAAGTACGCCGTTAGAGGTGCCATCCCAATGAGAGCTGAAGAATTGAAAGCT CAACTGGAGAAGGATCCTCAATCTCTGCCATTTGACAGGATTATCAACGCCAATATTGGT AATCCTCAGCAACTACAACAGAAACCTCTGACTTACTACAGACAGGTCTTGTCTCTCTTA CAATACCCAGAACTATTAAACCAAAACGAACAGCAGCTAGTTGATTCGAAATTGTTTAAA CTAGATGCCATTAAACGTGCAAAGAGTTTAATGGAAGATATCGGTGGTTCTGTTGGTGCT TACTCTTCTTCTCAAGGTGTAGAAGGTATAAGGAAAAGTGTCGCTGAATTTATAACGAAG AGGGACGAAGGCGAGATATCATACCCAGAGGATATTTTCCTAACTGCTGGTGCATCCGCA GCTGTCAATTACTTGTTATCAATTTTCTGTAGAGGGCCAGAAACGGGTGTCTTGATTCCA ATTCCTCAATATCCATTATATACCGCTACTCTAGCTTTGAACAATTCTCAAGCTTTACCA TACTATTTAGATGAGAATTCAGGTTGGTCAACTAATCCAGAAGAAATTGAAACTGTCGTC AAAGAGGCTATACAGAACGAAATCAAACCTACAGTTCTAGTGGTTATCAATCCAGGTAAT CCTACAGGAGCTGTCCTATCACCTGAGTCTATAGCTCAGATTTTTGAAGTCGCAGCCAAG TACGGTACAGTAGTGATAGCTGACGAAGTTTATCAAGAAAATATCTTCCCGGGCACCAAG TTCCATTCTATGAAGAAAATTTTGAGACATTTACAGAGGGAACATCCAGGTAAATTCGAT AATGTTCAGCTAGCTTCTTTGCATTCGACTTCTAAGGGTGTTTCTGGTGAATGTGGTCAA AGGGGTGGCTACATGGAACTCACTGGATTCAGCCATGAGATGAGACAAGTTATCTTGAAA CTAGCCTCGATTTCATTGTGTCCCGTTGTCACAGGTCAAGCTTTGGTTGATTTGATGGTT CGTCCACCAGTGGAAGGGGAGGAATCATTCGAGTCGGACCAAGCAGAACGTAACTCCATC CATGAAAAGTTAATTACAAGAGCAATGACACTGTATGAGACATTTAACTCTTTAGAAGGC ATTGAATGTCAAAAGCCTCAAGGTGCCATGTATTTATTCCCTAAGATAGACTTACCTTTC AAGGCAGTTCAAGAAGCTCGCCACTTAGAGTTAACTCCGGATGAATTTTATTGTAAGAAG TTGTTAGAATCTACTGGCATTTGCACTGTTCCCGGTTCTGGGTTTGGTCAAGAACCTGGT ACTTACCATTTAAGAACAACATTTTTGGCACCTGGTCTGGAATGGATTAAGAAATGGGAA AGTTTCCATAAAGAATTTTTTGACCAATACCGTGACTGA
Protein Properties
Pfam Domain Function
Protein Residues592
Protein Molecular Weight66421.10156
Protein Theoretical pI7.02
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable alanine aminotransferase, mitochondrial MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD
References
External Links
ResourceLink
Saccharomyces Genome Database ALT1
Uniprot IDP52893
Uniprot NameALAM_YEAST
GenBank Gene IDU53880
Genebank Protein ID1256891
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106