Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable alanine aminotransferase, mitochondrial
Synonyms
  • Glutamate pyruvate transaminase
  • GPT
  • Glutamic--alanine transaminase
  • Glutamic--pyruvic transaminase
Gene NameALT1
Enzyme Class
Biological Properties
General FunctionInvolved in 1-aminocyclopropane-1-carboxylate synthase activity
Specific FunctionL-alanine + 2-oxoglutarate = pyruvate + L- glutamate
Cellular LocationMitochondrion matrix
SMPDB Pathways
L-alanine metabolismPW002373 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
SMPDB Reactions
L-Alanine + Oxoglutaric acidPyruvic acid + L-Glutamic acid
KEGG Reactions
Oxoglutaric acid + L-AlaninePyruvic acid + L-Glutamic acid
Metabolites
YMDB IDNameView
YMDB00153Oxoglutaric acidShow
YMDB00154L-AlanineShow
YMDB00175Pyruvic acidShow
YMDB00271L-Glutamic acidShow
GO Classification
Component
Not Available
Function
lyase activity
binding
transferase activity, transferring nitrogenous groups
cofactor binding
pyridoxal phosphate binding
carbon-sulfur lyase activity
catalytic activity
1-aminocyclopropane-1-carboxylate synthase activity
transferase activity
Process
biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR089C
Gene Sequence>1779 bp ATGTTATCACTGTCTGCCAAAAATCACTTCACAGTGAGTAATTCTATAACTCACGTTATT AAGTCATATCATATAAGGACTCTCACTTCAAGCGCAGAAAAAATGCCACATATCACTACT CCTTTTTCTACCTCAGCCAGTAGTACAAAGTTAAAAGCTTTCAGGAAAGTTAGACCCGTC CTACAGAGACATAGCTCTTCCTGGATTGTTGCTCAAAATCATAGACGTTCATTATCTGGT CAATCTTCGCTAAACGACCTGCGTCATTTGAATCGCTTTCCACACCACACGTTGAAAACT TCGAATAACGAGTTTTATCCCGCCGAACAATTGACTTTGGAAGACGTAAATGAAAATGTC TTGAAGGCTAAGTACGCCGTTAGAGGTGCCATCCCAATGAGAGCTGAAGAATTGAAAGCT CAACTGGAGAAGGATCCTCAATCTCTGCCATTTGACAGGATTATCAACGCCAATATTGGT AATCCTCAGCAACTACAACAGAAACCTCTGACTTACTACAGACAGGTCTTGTCTCTCTTA CAATACCCAGAACTATTAAACCAAAACGAACAGCAGCTAGTTGATTCGAAATTGTTTAAA CTAGATGCCATTAAACGTGCAAAGAGTTTAATGGAAGATATCGGTGGTTCTGTTGGTGCT TACTCTTCTTCTCAAGGTGTAGAAGGTATAAGGAAAAGTGTCGCTGAATTTATAACGAAG AGGGACGAAGGCGAGATATCATACCCAGAGGATATTTTCCTAACTGCTGGTGCATCCGCA GCTGTCAATTACTTGTTATCAATTTTCTGTAGAGGGCCAGAAACGGGTGTCTTGATTCCA ATTCCTCAATATCCATTATATACCGCTACTCTAGCTTTGAACAATTCTCAAGCTTTACCA TACTATTTAGATGAGAATTCAGGTTGGTCAACTAATCCAGAAGAAATTGAAACTGTCGTC AAAGAGGCTATACAGAACGAAATCAAACCTACAGTTCTAGTGGTTATCAATCCAGGTAAT CCTACAGGAGCTGTCCTATCACCTGAGTCTATAGCTCAGATTTTTGAAGTCGCAGCCAAG TACGGTACAGTAGTGATAGCTGACGAAGTTTATCAAGAAAATATCTTCCCGGGCACCAAG TTCCATTCTATGAAGAAAATTTTGAGACATTTACAGAGGGAACATCCAGGTAAATTCGAT AATGTTCAGCTAGCTTCTTTGCATTCGACTTCTAAGGGTGTTTCTGGTGAATGTGGTCAA AGGGGTGGCTACATGGAACTCACTGGATTCAGCCATGAGATGAGACAAGTTATCTTGAAA CTAGCCTCGATTTCATTGTGTCCCGTTGTCACAGGTCAAGCTTTGGTTGATTTGATGGTT CGTCCACCAGTGGAAGGGGAGGAATCATTCGAGTCGGACCAAGCAGAACGTAACTCCATC CATGAAAAGTTAATTACAAGAGCAATGACACTGTATGAGACATTTAACTCTTTAGAAGGC ATTGAATGTCAAAAGCCTCAAGGTGCCATGTATTTATTCCCTAAGATAGACTTACCTTTC AAGGCAGTTCAAGAAGCTCGCCACTTAGAGTTAACTCCGGATGAATTTTATTGTAAGAAG TTGTTAGAATCTACTGGCATTTGCACTGTTCCCGGTTCTGGGTTTGGTCAAGAACCTGGT ACTTACCATTTAAGAACAACATTTTTGGCACCTGGTCTGGAATGGATTAAGAAATGGGAA AGTTTCCATAAAGAATTTTTTGACCAATACCGTGACTGA
Protein Properties
Pfam Domain Function
Protein Residues592
Protein Molecular Weight66421.10156
Protein Theoretical pI7.02
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable alanine aminotransferase, mitochondrial MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD
References
External Links
ResourceLink
Saccharomyces Genome Database ALT1
Uniprot IDP52893
Uniprot NameALAM_YEAST
GenBank Gene IDU53880
Genebank Protein ID1256891
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106