You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable alanine aminotransferase
Synonyms
  • Glutamate pyruvate transaminase
  • GPT
  • Glutamic--alanine transaminase
  • Glutamic--pyruvic transaminase
Gene NameALT2
Enzyme Class
Biological Properties
General FunctionInvolved in 1-aminocyclopropane-1-carboxylate synthase activity
Specific FunctionL-alanine + 2-oxoglutarate = pyruvate + L- glutamate
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00153Oxoglutaric acidShow
YMDB00154L-AlanineShow
YMDB00175Pyruvic acidShow
YMDB00271L-Glutamic acidShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
lyase activity
binding
transferase activity, transferring nitrogenous groups
cofactor binding
pyridoxal phosphate binding
carbon-sulfur lyase activity
1-aminocyclopropane-1-carboxylate synthase activity
Process
metabolic process
biosynthetic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR111C
Gene Sequence>1524 bp ATGACAATGACACACCAACAGGATTTGAAAGGTGTGTTCACCGCAAAGGATTTGGATTTT AAGCCCGCTGGCAAGATTACTAAAAAAGATTTGAATACAGGTGTCACTAAGGCAGAATAT GCTGTAAGAGGAGCTATTCCAACCAGAGCTGACGAGCTAAAAGAGGAATTGAAAAAAAAC CCAGAAGTTTTGCCTTTCGATGATATTATCAATGCGAACATTGGTAATCCGCAGCAACTG GATCAGAAGCCTTTGACCTTTACCAGGCAAGTACTGGCCATCCTGGAGTACCCGGAAATT TTACGAGTAGGCCATAATGAACTGGCTTCTTTGAACTTGTTTTCCAGGGACGCCTTGGAA AGAGCTGAGCGCCTCTTGAATGATATTGGCGGTTCTATAGGGGCATATTCGCATTCTCAA GGTGTGCCAGGAATAAGGCAAACAGTTGCTGACTTCATTACTAGAAGAGACGGCGGTGAG CCCGCTACACCGGAAGATATTTATTTAACCACTGGCGCTTCGTCCGCGGCAACTTCTTTG TTATCTTTATTGTGTAAAGATTCTCAAACAGGCCTGCTGATTCCAATTCCGCAGTATCCG CTTTATACTGCATCCGCATCTCTTTTCAATGCACAAGTGCTGCCATACTACTTAGATGAG GAGTCAAATTGGTCTACAAACAGCGACGAAATTGAAAAAGTAGTGCAAGATGCTTTGAAA AAACAGATCAGACCATCTGTGCTGATAGTTATTAATCCAGGTAACCCAACCGGTGCAGTT CTTTCTGAAGAAACCATTGCCAGGATCTGTTTGATCGCTGCGAAATACGGCATTACAATC ATTTCTGATGAGGTCTATCAAGAAAACATTTTCAACGATGTTAAATTTCATTCGATGAAG AAAGTCCTAAGAAAATTGCAGCATCTTTATCCAGGAAAATTCGATAACGTTCAGCTCGCC TCTTTACACTCCATTTCTAAAGGATTCATGGATGAGTGCGGCCAAAGAGGCGGTTACATG GAAATTATTGGGTTTTCTCAAGAAATAAGAGATGCTCTTTTCAAACTCATGTCTATATCC ATATGTTCTGTTGTCACAGGACAAGCTGTGGTTGATTTAATGGTCAAACCACCCCAGCCT GGAGACGAGTCCTATGAACAAGATCATGACGAAAGGCTGAAAATTTTTCATGAAATGCGT ACGAGAGCAAACTTATTGTACGAGACGTTTAAGGAACTAGAGGGTATCGAATGCCAAGAA CCTCAGGGTGCAATGTATCTTTTCCCTAGGCTTGTTTTACCTAAGAAAGCTCTTTGTGAA AGCGAACGCCTTGGCATCGAACCTGATGAGTTCTATTGCACATCTTTGCTAGAATCTACA GGTATTTGTACTGTCCCAGGGTCTGGGTTCGGACAAAGACCCGGGACTTATCATGTGCGA ACAACGTTTTTGGCTCCAGGGACTAAATGGATTCAAGACTGGAAAGAATTTCATCAAGAT TTCTTCAGCAAGTATCGTAATTGA
Protein Properties
Pfam Domain Function
Protein Residues507
Protein Molecular Weight56769.30078
Protein Theoretical pI5.53
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable alanine aminotransferase MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN PEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALE RAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSL LSLLCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALK KQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK KVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSIS ICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQK PQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVR TTFLAPGTKWIQDWKEFHQDFFSKYRN
References
External Links
ResourceLink
Saccharomyces Genome Database ALT2
Uniprot IDP52892
Uniprot NameALAT_YEAST
GenBank Gene IDAY723777
Genebank Protein ID51830240
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106