You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGTP cyclohydrolase 1
Synonyms
  • GTP cyclohydrolase I
  • GTP-CH-I
Gene NameFOL2
Enzyme Class
Biological Properties
General FunctionInvolved in GTP cyclohydrolase I activity
Specific FunctionGTP + H(2)O = formate + 2-amino-4-hydroxy-6- (erythro-1,2,3-trihydroxypropyl)-dihydropteridine triphosphate
Cellular LocationCytoplasmic
SMPDB Pathways
tetrahydrofolate biosynthesisPW002417 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Folate biosynthesisec00790 Map00790
SMPDB Reactions
GTP + waterFormic acid + hydron + 7,8-dihydroneopterin 3'-triphosphate
KEGG Reactions
GTP + water7,8-dihydroneopterin 3'-triphosphate + Formic acid + hydron
Metabolites
YMDB IDNameView
YMDB00385Formic acidShow
YMDB00558GTPShow
YMDB005787,8-dihydroneopterin 3'-triphosphateShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
cytoplasm
cell part
intracellular part
Function
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
cyclohydrolase activity
GTP cyclohydrolase activity
GTP cyclohydrolase I activity
catalytic activity
Process
cellular aromatic compound metabolic process
folic acid and derivative metabolic process
folic acid and derivative biosynthetic process
tetrahydrofolate biosynthetic process
metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR267C
Gene Sequence>732 bp ATGCATAACATCCAATTAGTGCAAGAGATAGAAAGACATGAAACCCCGTTAAACATTAGA CCTACCTCTCCATACACTTTAAACCCTCCTGTCGAGAGAGATGGGTTTTCTTGGCCAAGT GTGGGTACAAGACAACGTGCAGAGGAAACTGAAGAGGAGGAAAAGGAACGAATTCAACGC ATTTCAGGCGCTATCAAGACAATTTTGACCGAACTGGGTGAAGATGTCAACAGAGAAGGT CTACTAGATACTCCACAAAGATACGCTAAAGCCATGCTTTATTTCACTAAAGGTTACCAA ACGAACATTATGGACGATGTCATTAAGAATGCTGTCTTTGAAGAAGATCATGATGAAATG GTTATTGTTCGTGATATTGAAATTTACTCGTTATGTGAACATCATTTGGTGCCATTTTTC GGCAAGGTTCATATCGGGTATATACCAAATAAAAAAGTCATCGGGTTAAGTAAGTTGGCC AGATTGGCAGAAATGTATGCGAGAAGGCTCCAAGTTCAAGAAAGACTTACAAAGCAAATT GCAATGGCCCTAAGTGATATTCTAAAACCATTAGGTGTAGCCGTTGTTATGGAAGCTTCT CATATGTGCATGGTTTCAAGAGGCATTCAAAAAACGGGATCTTCTACGGTAACTTCTTGT ATGCTTGGAGGGTTTAGGGCTCATAAAACAAGAGAAGAGTTTTTAACTCTTTTAGGAAGA AGAAGTATTTGA
Protein Properties
Pfam Domain Function
Protein Residues243
Protein Molecular Weight27768.80078
Protein Theoretical pI7.25
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>GTP cyclohydrolase 1 MHNIQLVQEIERHETPLNIRPTSPYTLNPPVERDGFSWPSVGTRQRAEETEEEEKERIQR ISGAIKTILTELGEDVNREGLLDTPQRYAKAMLYFTKGYQTNIMDDVIKNAVFEEDHDEM VIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVIGLSKLARLAEMYARRLQVQERLTKQI AMALSDILKPLGVAVVMEASHMCMVSRGIQKTGSSTVTSCMLGGFRAHKTREEFLTLLGR RSI
References
External Links
ResourceLink
Saccharomyces Genome Database FOL2
Uniprot IDP51601
Uniprot NameGCH1_YEAST
GenBank Gene IDAY692993
Genebank Protein ID51013437
General Reference
  • Nardese, V., Gutlich, M., Brambilla, A., Carbone, M. L. (1996). "Disruption of the GTP-cyclohydrolase I gene in Saccharomyces cerevisiae." Biochem Biophys Res Commun 218:273-279.8573145
  • Agostoni Carbone, M. L., Lucchini, G., Melchioretto, P., Nardese, V., Vanoni, M., Panzeri, L. (1998). "A 9359 bp fragment from the right arm of Saccharomyces cerevisiae chromosome VII includes the FOL2 and YTA7 genes and three unknown open reading frames." Yeast 14:587-591.9605509
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Maier, J., Witter, K., Gutlich, M., Ziegler, I., Werner, T., Ninnemann, H. (1995). "Homology cloning of GTP-cyclohydrolase I from various unrelated eukaryotes by reverse-transcription polymerase chain reaction using a general set of degenerate primers." Biochem Biophys Res Commun 212:705-711.7542887
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956