You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHigh-affinity methionine permease
SynonymsNot Available
Gene NameMUP1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionHigh affinity permease for methionine
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00318L-MethionineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
establishment of localization
transport
amine transport
amino acid transport
transmembrane transport
Gene Properties
Chromosome Locationchromosome 7
LocusYGR055W
Gene Sequence>1725 bp ATGTCGGAAGGAAGAACGTTTCTGTCACAGTTGAATGTCTTCAACAAGGAGAACTATCAA TTTTCTTCTTCTACTACAAAAAAGGAAGTAAGTAACTCAACAGTGGATGCTGACAACGGT GCCTCCGATTTTGAGGCAGGCCAGCAATTTGCTACAGAATTGGACCAAGGTGAAAAGCAG TTAGGTATTTTGTCGTGTATTGGGCTTATCTGTAATAGAATGCTTGGTACCGGTGTTTTC GCCGTTTCCTCGACCATTTACACACTATGTGGGTCTGTGGGGCTTGCATTAATTATGTGG GCAGTTGGTGCCATTATTGCCATTTCTGGGTTATATGTATACATGGAATTCGGTACGGCT ATACCGAAAAATGGTGGTGAAAAAAACTACCTGGAGGCCATTTTCAGGAAACCAAAATTC TTCATTACCTGTATGTATGCTGCGTATATTTTCTTCCTAGGTTGGGCTGCTGGTAATTCT ATCAATACAGCTATTATGTTTTTAACTGCTGCTGATACTGAAGTGACCAAATGGAATCAA AGAGGTATTGGTGTGGCCGTCGTTTTTTTTGCATTCCTAATTAATTCTCTGAATGTCAAG ATTGGTCTATATTTGCAAAACATTTTAGGTATTTTCAAGATTGGTATTGTCCTCTTCATT TCTATTACCGGTTGGGTTGCCCTTGGCGGTGGTCTCAAAGATGGTTATCAATCTCACAAC TTTCGTAATGCTTTTGAAGGTACTGAAACCGCCACTGCTTATGGTATTGTTAACGCCTTA TATAGTGTTATTTGGTCGTTTGTCGGTTACTCCAATGTTAACTATGCACTTGGTGAAGTT AAGAACCCTGTGAGAACTTTGAAGATTGCTGGTCCTACATCGATGGTCTTCTTGGCTATA ATCTACATTTTTGTGAACATTGCTTACTTCGCTGTGGTTCCAAAAGATAAGTTAATTTCT TCAAAATTGATTTTAGCTGCTGACTTCTTCGATATTGTGTTTGGCGGCCAAGCCAAGAGA GCAGCAGCCGCACTGGTCGGGTTGAGTGCCTTAGGAAATGTTCTTTCTGTCATTTTTTCT CAGGGTAGAATTATTCAACAACTAGGACGTGAAGGTGTGTTGCCCTTTTCTAATTTCTTT GCCTCTTCTAAGCCATTCAACTCCCCAATGGTTGGTTTGTTTCAACATTTTATTGTTTGT ACAGTAACCATCTTAGCCCCACCTCCAGGTGATGCATATTTGCTAGTCCAAAATTTAATT TCCTACCCAATGAATATTATTAATTTTGCTATTAGCGCGGGTTTGCTTTGGATATACTGG CAACGTAGACAAGGTAAAATTGAATGGAACCCACCAATTAAGGCCGGTGTTTTTGTTACG GGATTTTTCACATTATCCAATTTATACCTGATTATTGCTCCTTACGTTCCACCTTCAAAT GGCGAGTCGGTGTATTCAAGCATGCCATACTGGATCCACTGTGTAATTGCTTGGGGTATT TTCTTCTTTGGTGGTGTTTACTACGTTGTTTGGGCCCAATTATTGCCAAGATGGGGCCAC TACAAATTGGTTTCCAAGGATGTGCTTGGTGAAGATGGGTTCTGGAGAGTCAAAATTGCC AAAGTTTATGATGACACTATTGGCGATGTCGATACACAAGAAGACGGCGTTATTGAAACG AATATAATCGAACATTACAAAAGTGAACAAGAAAAATCGCTGTAA
Protein Properties
Pfam Domain Function
Protein Residues574
Protein Molecular Weight63220.80078
Protein Theoretical pI7.78
Signalling Regions
  • None
Transmembrane Regions
  • 62-82
  • 93-113
  • 141-161
  • 183-203
  • 208-228
  • 294-314
  • 341-361
  • 419-439
  • 456-476
  • 491-511
Protein Sequence>High-affinity methionine permease MSEGRTFLSQLNVFNKENYQFSSSTTKKEVSNSTVDADNGASDFEAGQQFATELDQGEKQ LGILSCIGLICNRMLGTGVFAVSSTIYTLCGSVGLALIMWAVGAIIAISGLYVYMEFGTA IPKNGGEKNYLEAIFRKPKFFITCMYAAYIFFLGWAAGNSINTAIMFLTAADTEVTKWNQ RGIGVAVVFFAFLINSLNVKIGLYLQNILGIFKIGIVLFISITGWVALGGGLKDGYQSHN FRNAFEGTETATAYGIVNALYSVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSMVFLAI IYIFVNIAYFAVVPKDKLISSKLILAADFFDIVFGGQAKRAAAALVGLSALGNVLSVIFS QGRIIQQLGREGVLPFSNFFASSKPFNSPMVGLFQHFIVCTVTILAPPPGDAYLLVQNLI SYPMNIINFAISAGLLWIYWQRRQGKIEWNPPIKAGVFVTGFFTLSNLYLIIAPYVPPSN GESVYSSMPYWIHCVIAWGIFFFGGVYYVVWAQLLPRWGHYKLVSKDVLGEDGFWRVKIA KVYDDTIGDVDTQEDGVIETNIIEHYKSEQEKSL
References
External Links
ResourceLink
Saccharomyces Genome Database MUP1
Uniprot IDP50276
Uniprot NameMUP1_YEAST
GenBank Gene IDDQ115391
Genebank Protein ID71064041
General Reference
  • Isnard, A. D., Thomas, D., Surdin-Kerjan, Y. (1996). "The study of methionine uptake in Saccharomyces cerevisiae reveals a new family of amino acid permeases." J Mol Biol 262:473-484.8893857
  • Deutschbauer, A. M., Davis, R. W. (2005). "Quantitative trait loci mapped to single-nucleotide resolution in yeast." Nat Genet 37:1333-1340.16273108
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956