You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable inosine-5'-monophosphate dehydrogenase IMD3
Synonyms
  • IMP dehydrogenase
  • IMPD
  • IMPDH
Gene NameIMD3
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionInosine 5'-phosphate + NAD(+) + H(2)O = xanthosine 5'-phosphate + NADH
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Inosinic acid + NAD + waterNADH + Xanthylic acid + hydron
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00289Xanthylic acidShow
YMDB00352Inosinic acidShow
YMDB00412NAD(+)Show
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
IMP dehydrogenase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR432W
Gene Sequence>1572 bp ATGGCCGCCGTTAGAGACTACAAGACTGCCTTGGAATTCGCCAAGAGCTTACCAAGACTA GATGGTTTGTCTGTCCAGGAGTTGATGGACTCCAAGACCAGAGGTGGGTTGACTTATAAC GACTTTTTGGTTTTGCCAGGTCTGGTTGATTTCCCATCTTCTGAAGTTAGCCTACAAACT AAGTTGACAAGGAATATCACTTTGAACACCCCATTCGTTTCCTCTCCAATGGACACCGTG ACAGAATCAGAAATGGCCATCTTCATGGCTTTGTTGGGTGGTATCGGTTTTATTCACCAC AACTGTACCCCAGAGGACCAAGCTGACATGGTCAGAAGAGTCAAGAACTATGAAAATGGG TTTATTAACAACCCTATAGTGATTTCCCCAACTACTACTGTGGGTGAAGCTAAGAGTATG AAGGAAAGATTTGGATTTTCCGGTTTCCCCGTTACAGAAGATGGTAAAAGAAACGGAAAA TTGATGGGTATCGTCACTTCTCGTGATATTCAGTTCGTTGAAGACAACTCTTTGCTTGTT CAAGATGTTATGACCAAAAACCCTGTCACCGGTGCACAAGGTATTACATTGTCTGAAGGT AATGAAATTTTAAAGAAGATTAAAAAGGGTAAGCTATTGATTGTTGACGACAATGGTAAC TTAGTTTCTATGCTTTCCAGAACTGATTTAATGAAAAATCAGAACTATCCATTGGCTTCT AAATCTGCCACCACCAAGCAACTGTTATGTGGTGCTGCTATCGGTACTATCGATGCTGAT AAGGAAAGGTTAAGACTATTAGTCGAAGCAGGTTTGGATGTTGTTATCTTAGATTCCTCT CAAGGTAACTCTATTTTCCAATTGAACATGATCAAATGGATTAAAGAAACTTTCCCAGAT TTGGAAATCATTGCTGGTAACGTTGCCACCAGAGAACAAGCTGCTAACTTGATTGCTGCC GGTGCCGATGGTTTAAGAATTGGTATGGGTTCAGGCTCTATTTGTATCACTCAAGAAGTT ATGGCCTGTGGTAGACCACAAGGTACAGCCGTCTACAACGTGTGTGAATTTGCTAACCAA TTCGGTATTCCATGTATGGCTGATGGTGGTGTTCAAAACATTGGTCATATTACCAAAGCT TTGGCTCTTGGTTCTTCTACTGTTATGATGGGTGGTATGTTAGCTGGTACTACTGAATCT CCTGGTGAATATTTCTATCAAGATGGTAAAAGATTGAAGGCATATCGTGGTATGGGTTCC ATTGACGCCATGCAAAAGACTGGTACTAAAGGTAATGCATCTACCTCCCGTTACTTTTCC GAATCAGACAGTGTTTTGGTCGCACAAGGTGTCTCCGGTGCTGTCGTTGACAAAGGTTCT ATCAAGAAATTTATTCCATATTTGTACAACGGTTTACAACATTCTTGTCAAGACATTGGT TACAAGTCCCTAACTTTATTAAAGGAAAATGTCCAAAGCGGTAAAGTTAGATTTGAATTT AGAACCGCTTCTGCTCAACTAGAAGGTGGTGTTCATAACTTACATTCTTACGAAAAGCGT TTACATAACTAA
Protein Properties
Pfam Domain Function
Protein Residues523
Protein Molecular Weight56584.39844
Protein Theoretical pI7.46
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable inosine-5'-monophosphate dehydrogenase IMD3 MAAVRDYKTALEFAKSLPRLDGLSVQELMDSKTRGGLTYNDFLVLPGLVDFPSSEVSLQT KLTRNITLNTPFVSSPMDTVTESEMAIFMALLGGIGFIHHNCTPEDQADMVRRVKNYENG FINNPIVISPTTTVGEAKSMKERFGFSGFPVTEDGKRNGKLMGIVTSRDIQFVEDNSLLV QDVMTKNPVTGAQGITLSEGNEILKKIKKGKLLIVDDNGNLVSMLSRTDLMKNQNYPLAS KSATTKQLLCGAAIGTIDADKERLRLLVEAGLDVVILDSSQGNSIFQLNMIKWIKETFPD LEIIAGNVATREQAANLIAAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVCEFANQ FGIPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYQDGKRLKAYRGMGS IDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIG YKSLTLLKENVQSGKVRFEFRTASAQLEGGVHNLHSYEKRLHN
References
External Links
ResourceLink
Saccharomyces Genome Database IMD3
Uniprot IDP50095
Uniprot NameIMDH3_YEAST
GenBank Gene IDU21094
Genebank Protein ID665971
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106