Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTyrosyl-tRNA synthetase, mitochondrial
Synonyms
  • Tyrosine--tRNA ligase
  • TyrRS
Gene NameMSY1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionCatalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction:tyrosine is first activated by ATP to form Tyr- AMP and then transferred to the acceptor end of tRNA(Tyr)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Tyrosine + Adenosine triphosphate + tRNA(Tyr) → Adenosine monophosphate + Pyrophosphate + Tyr-tRNA(Tyr)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00364L-TyrosineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
tyrosine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
tyrosyl-tRNA aminoacylation
Gene Properties
Chromosome Locationchromosome 16
LocusYPL097W
Gene Sequence>1479 bp ATGCTCGAATTACGAAGTTGTAGTAATTTGGTCAATAGTAGTAGGAGACTTGTGCCTCTG GTGACTTATTCCGGACTAAGTGCAATAACATTGCCTAAATCTCGATTTTATTCACAGCCT AGTGCTTTAGAAGTACAGGGCACATCGGATTCTCGAAGCGATAATATTTTAGACGAACTC AAACAAAGGGGTCTAGTGTCCCAGGTCTCACAGCCAGAGAGTTTCCTTCGGACGAAGTTG AACGGTAACGATAAGATCAAATTATACTGCGGGGTGGATCCCACAGCTCAGTCACTTCAT TTGGGAAATCTAGTTCCACTAATGGTTTTATTACACTTTTACGTAAAAGGTCACGACATT GTCACTGTGATAGGTGGAGCTACAGGGAAAGTTGGGGACCCAAGTGGTAGGAAAACAGAA AGAGACGTTATGGAGAACGATATTAGGCAAAGCAATGTGGCATCCATCTCGCAGCAATTA CAAAGGTTTTTCAAAAATGGCCTAGAATATTACAGAAACCGATGTGCTCTCACTGAAGAT GTACCTTCCGGAAAATATACACCAAGGAATAATTTCAACTGGTGGAAAGACATCAAAATG TTGGATTTCTTAGCTGATTTTGGTAGGCACATTCGGGTACAATCTATGTTGGCGAGGGAT TCAATTTCTTCGAGGCTTCAAACCAAAAATGGTCTGGGATTTAACGAATTTACTTACCAA GTTTTACAAGCGTACGATTTTTACCATTTGTATAAGGAAGAGAATGTGACTATACAAGTA GGTGGTAACGACCAATGGGGAAATATAACAGCCGGTATCGATCTCATCAATAGGATACAG CCTATAAAGAATAAGGGTTTGCCATTTGGTATCACTGTGCCCTTGTTGACGACGGCTACA GGAGAGAAATTTGGGAAAAGTGCAGGCAATGCTGTTTTTATTGACCCCTCAATCAATACG GCGTATGATGTTTACCAGTTCTTTTATAATACTTTGGATGCTGATGTACCCAAGTTCTTG AAGATCTTTACGTTTTTAAACTCAAGTGAAATCAAAAAAATTGTGGAAACGCATATCAAA TCACCCAGTCTACGTTATGGCCAAACTTTATTGGCTAAAGAAGTCACAGATATGTTATAT GGAGTTGGCTCCGGATCGGATTCAGAAGCGCTTTCTAATATTATTTTTGGACGTTATGAC GGAACTTTATCTGCTGCGAAGTTAGTTGATCTATGTAAAAAAGCCAGAATTTTGCAGTAT GCTGATAGAGAGATTGACTTAATAAAGTTAATTTGTAAACTAGTAAATTGTTCAGTATCA GAAGCCAGAAGAAAACTTTCCCAGGGAAGCGTGTATCTGCATCATTCAAAATCTAAAGTA AACGAAAATATTTCTAACTTGGCTCCTTTCCTGATAGATGATCGAGTACTGATCTTGAGG ATAGGAAAGCAGAAGTGTTTTATAATAGAAATGCGTTAA
Protein Properties
Pfam Domain Function
Protein Residues492
Protein Molecular Weight55286.89844
Protein Theoretical pI9.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Tyrosyl-tRNA synthetase, mitochondrial MLELRSCSNLVNSSRRLVPLVTYSGLSAITLPKSRFYSQPSALEVQGTSDSRSDNILDEL KQRGLVSQVSQPESFLRTKLNGNDKIKLYCGVDPTAQSLHLGNLVPLMVLLHFYVKGHDI VTVIGGATGKVGDPSGRKTERDVMENDIRQSNVASISQQLQRFFKNGLEYYRNRCALTED VPSGKYTPRNNFNWWKDIKMLDFLADFGRHIRVQSMLARDSISSRLQTKNGLGFNEFTYQ VLQAYDFYHLYKEENVTIQVGGNDQWGNITAGIDLINRIQPIKNKGLPFGITVPLLTTAT GEKFGKSAGNAVFIDPSINTAYDVYQFFYNTLDADVPKFLKIFTFLNSSEIKKIVETHIK SPSLRYGQTLLAKEVTDMLYGVGSGSDSEALSNIIFGRYDGTLSAAKLVDLCKKARILQY ADREIDLIKLICKLVNCSVSEARRKLSQGSVYLHHSKSKVNENISNLAPFLIDDRVLILR IGKQKCFIIEMR
References
External Links
ResourceLink
Saccharomyces Genome Database MSY1
Uniprot IDP48527
Uniprot NameSYYM_YEAST
GenBank Gene IDL42333
Genebank Protein ID825503
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Reinders, J., Zahedi, R. P., Pfanner, N., Meisinger, C., Sickmann, A. (2006). "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics." J Proteome Res 5:1543-1554.16823961