Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable NADPH:adrenodoxin oxidoreductase, mitochondrial
Synonyms
  • AR
  • Adrenodoxin reductase
  • Ferredoxin--NADP(+) reductase
  • Ferredoxin reductase
Gene NameARH1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific Function2 reduced ferredoxin + NADP(+) + H(+) = 2 oxidized ferredoxin + NADPH
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR376W
Gene Sequence>1482 bp ATGAGCTTTGTTCAAATAAGGCACATTTCTTCACAAATAAACCGTAAGACTGTATCCATT GTTGGATCGGGGCCTTCCGGCTTTTATACAGCGTACCATTTACTCAAGAAGTCACCGATT CCATTAAATGTTACTATATGGGAAAAGTTACCTGTTCCTTTTGGTTTAAGTAGATATGGT GTGGCACCTGATCATCCAGAAGTCAAAAATTGTGAAGAAACGTTTACCACATGTGCAGAA GAGTTTTCTTCCCCTACAAACCAAAAGCATAAATTTTCCTTTGTTGGTGGTATAACCATT GGAAAAGAAATATTGTTGAAGGAATTGCTGGATAATCAAGATGCTGTTATTTTAAGTTAT GGTTGTACAGGGGACAGAAAGCTGAATATCCCTAGCGAACTCGGAACAAAAGGGGTGTTT AGCAGTAGAGAATTTGTCAATTGGTACAATGGTCATCCTGATTTCGCAAAGGATAAGCGA TTTACCGATTTTGACTGGAGCAAAGTTTCGAAAGTTGGTATTATAGGAAACGGTAACGTT GCTCTTGATATTACGCGTGTACTTATTTCTAATCAAATTGATGAAATATGGGAAAATACG GACATCTCATCTCTTGCACTAAATTTGCTAAGAAGGGCACCTGTAAAGGACGTTAAGCTA ATTGCACGAAGGGATTTCGTTCATTCCAAATTCACCAACAAAGAATTAAGAGAACTATGG GAGTTAGAAAAGTATGGCATACGTGGCCGTATTGATCCTAAATTTTTCCAGAAAGAAATG TTTGACCCATCTAAGTACGATCGTGCATTCAATAGACGAGTAGAGATGTGTAGTGAGTAT CTCAAGCCATTTAATGAACGTTCGAAGAAAAACTATAAAAAGGCTCCTCCTCCAAGCAGC GGATATGACAAATTCTGGGAGTTAGATTATTTGAAGACTCCCTTGAAAATTAATAGAGAC GATTTTGGTGCAATCAACTCTTTGAGTTTATGTAACAATCGATTAAATGAAGATAACAGT TTGCAACCCTTGAAGGACGTCAATAATATTATGACATATAAAGTGGATTTGCTGATTACT TCATTGGGATATGCAGGCGTTCCCATGCCTGAATTCTCTAAGTTGTCTATTGGATTTGAC AAAGATCATATAGCTAATAAACAGGGTCGTGTTTTAACTTCCAGCGGAGAAATATTCCCA CATTTATATGCATCTGGTTGGATCCGTAAGGGCAGCCAGGGCGTTATTGCCTCGACAATG CAAGATGCTTTTGAAGTTGGAGACAGAGTAATACAAGACTTGGTGGTCAGCGGAGCGCTT TCCTTAGAGAATTCTATCGACCTCTCTAATATCAAGCACACCACATGGAAGGATTGGGAA AGAATCAACAAGAAGGAATTGCTTCGGGGCAAAAAGGAACACAAAACTCGGTCAAAGTTT TTAACTTTTGAAGAGTTGTGGAACGGTGTAGAAGGCATATAA
Protein Properties
Pfam Domain Function
Protein Residues493
Protein Molecular Weight56236.69922
Protein Theoretical pI9.36
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable NADPH:adrenodoxin oxidoreductase, mitochondrial MSFVQIRHISSQINRKTVSIVGSGPSGFYTAYHLLKKSPIPLNVTIWEKLPVPFGLSRYG VAPDHPEVKNCEETFTTCAEEFSSPTNQKHKFSFVGGITIGKEILLKELLDNQDAVILSY GCTGDRKLNIPGELGTKGVFSSREFVNWYNGHPDFAKDKRFTDFDWSKVSKVGIIGNGNV ALDITRVLISNQIDEIWENTDISSLALNLLRRAPVKDVKLIARRDFVHSKFTNKELRELW ELEKYGIRGRIDPKFFQKEMFDPSKYDRAFNRRVEMCSEYLKPFNERSKKNYKKAPPPSS GYDKFWELDYLKTPLKINRDDFGAINSLSLCNNRLNEDNSLQPLKDVNNIMTYKVDLLIT SLGYAGVPMPEFSKLSIGFDKDHIANKQGRVLTSSGEIFPHLYASGWIRKGSQGVIASTM QDAFEVGDRVIQDLVVSGALSLENSIDLSNIKHTTWKDWERINKKELLRGKKEHKTRSKF LTFEELWNGVEGI
References
External Links
ResourceLink
Saccharomyces Genome Database ARH1
Uniprot IDP48360
Uniprot NameADRO_YEAST
GenBank Gene IDU28038
Genebank Protein ID881497
General Reference
  • Manzella, L., Barros, M. H., Nobrega, F. G. (1998). "ARH1 of Saccharomyces cerevisiae: a new essential gene that codes for a protein homologous to the human adrenodoxin reductase." Yeast 14:839-846.9818721
  • Lacour, T., Dumas, B. (1996). "A gene encoding a yeast equivalent of mammalian NADPH-adrenodoxin oxidoreductases." Gene 174:289-292.8890749
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Nobrega, F. G., Nobrega, M. P., Tzagoloff, A. (1992). "BCS1, a novel gene required for the expression of functional Rieske iron-sulfur protein in Saccharomyces cerevisiae." EMBO J 11:3821-3829.1327750
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106