You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative cystathionine beta-lyase
Synonyms
  • CBL
  • Beta-cystathionase
  • Cysteine lyase
  • Increased recombination centers protein 7
Gene NameIRC7
Enzyme Class
Biological Properties
General FunctionInvolved in pyridoxal phosphate binding
Specific FunctionL-cystathionine + H(2)O = L-homocysteine + NH(3) + pyruvate
Cellular LocationNot Available
SMPDB Pathways
Cysteine MetabolismPW002383 ThumbThumb?image type=greyscaleThumb?image type=simple
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Nitrogen metabolismec00910 Map00910
Selenocompound metabolismec00450 Map00450
Sulfur metabolismec00920 Map00920
SMPDB Reactions
Homocysteine + Pyruvic acid + Ammoniumwater + L-Cystathionine
Selenocystathionine + waterSelenohomocysteine + Ammonia + Pyruvic acid
KEGG Reactions
L-Cystathionine + waterL-Homocysteine + Pyruvic acid + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00175Pyruvic acidShow
YMDB00245L-CystathionineShow
YMDB00371HomocysteineShow
YMDB00423AmmoniumShow
YMDB00520L-HomocysteineShow
YMDB00890waterShow
YMDB16178SelenohomocysteineShow
YMDB16184SelenocystathionineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
pyridoxal phosphate binding
carbon-sulfur lyase activity
cystathionine beta-lyase activity
catalytic activity
lyase activity
binding
cofactor binding
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFR055W
Gene Sequence>1023 bp ATGTCTACAGACAAGATCACATTTTTGTTGAACTGGCAACCAACCCCATACCATATTCCA ATTTTCTTGGCTCAAACCAAAGGTTACTTCAAGGAGCAAGGTCTAGACATGGCCATCCTA GAACCAACCAATCCTTCCGATGTCACTGAGTTAATTGGATCTGGTAAGGTCGACATGGGT TTGAAAGCCATGATCCACACCTTGGCTGCCAAGGCCCGTGGTTTCCCAGTGACCTCTGTT GCCTCTTTGTTGGACGAACCATTTACCGGTGTCTTGTACTTAAAGGGCAGTGGTATCACT GAAGACTTCCAGTCCCTAAAGGGTAAGAAGATCGGTTACGTTGGTGAATTCGGTAAGATC CAAATCGATGAATTGACCAAGCACTACGGTATGAAGCCAGAAGACTACACCGCCGTCAGA TGTGGTATGAATGTCGCCAAGTACATCATCGAAGGTAAGATTGATGCCGGTATTGGTATC GAATGTATGCAACAAGTCGAATTGGAAGAGTACTTGGCCAAGCAAGGCAGACCAGCTTCT GATGCTAAAATGTTGAGAATTGACAAGTTGGCTTGCTTGGGTTGCTGTTGCTTCTGTACC GTTCTTTACATCTGCAACGATGAATTTTTGAAGAAGAACCCTGAAAAGGTCAGAAAGTTC TTGAAAGCCATCAAGAAGGCAACCGACTACGTTCTAGCCGACCCTGTGAAGGCTTGGAAA GAATACATCGACTTCAAGCCTCAATTGAACAACGATCTATCCTACAAGCAATACCAAAGA TGTTACGCTTACTTCTCTTCATCTTTGTACAATGTTCACCGTGACTGGAAGAAGGTTACC GGTTACGGTAAGAGATTAGCCATCTTGCCACCAGACTATGTCTCGAACTACACTAATGAA TACTTGTCCTGGCCAGAACCAGAAGAGGTTTCTGATCCTTTGGAAGCTCAAAGATTGATG GCTATTCATCAAGAAAAATGCAGACAGGAAGGTACTTTCAAGAGATTGGCTCTTCCAGCT TAA
Protein Properties
Pfam Domain Function
Protein Residues340
Protein Molecular Weight36971.10156
Protein Theoretical pI6.05
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative cystathionine beta-lyase MIDRTELSKFGITTQLSVIGRNPDEQSGFVNPPLYKGSTIILKKLSDLEQRKGRFYGTAG SPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVYVPTRMLCDG LLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVSVAKKHGIKT ILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIGLASANEECWPLLRSTYDAMAM LPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGNRDEVEKVLHPAFEDCPGHEYWVR DYKGSSGLFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGG
References
External Links
ResourceLink
Saccharomyces Genome Database IRC7
Uniprot IDP43623
Uniprot NameMETC_YEAST
GenBank Gene IDD50617
Genebank Protein ID836697
General Reference
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Eki, T., Naitou, M., Hagiwara, H., Ozawa, M., Sasanuma, S. I., Sasanuma, M., Tsuchiya, Y., Shibata, T., Hanaoka, F., Murakami, Y. (1996). "Analysis of a 36.2 kb DNA sequence including the right telomere of chromosome VI from Saccharomyces cerevisiae." Yeast 12:149-167.8686379
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106