Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative cystathionine beta-lyase
Synonyms
  • CBL
  • Beta-cystathionase
  • Cysteine lyase
  • Increased recombination centers protein 7
Gene NameIRC7
Enzyme Class
Biological Properties
General FunctionInvolved in pyridoxal phosphate binding
Specific FunctionL-cystathionine + H(2)O = L-homocysteine + NH(3) + pyruvate
Cellular LocationNot Available
SMPDB Pathways
Cysteine MetabolismPW002383 ThumbThumb?image type=greyscaleThumb?image type=simple
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Nitrogen metabolismec00910 Map00910
Selenocompound metabolismec00450 Map00450
Sulfur metabolismec00920 Map00920
SMPDB Reactions
Homocysteine + Pyruvic acid + Ammoniumwater + L-Cystathionine
Selenocystathionine + waterSelenohomocysteine + Ammonia + Pyruvic acid
KEGG Reactions
L-Cystathionine + waterL-Homocysteine + Pyruvic acid + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00175Pyruvic acidShow
YMDB00245L-CystathionineShow
YMDB00371HomocysteineShow
YMDB00423AmmoniumShow
YMDB00520L-HomocysteineShow
YMDB00890waterShow
YMDB16178SelenohomocysteineShow
YMDB16184SelenocystathionineShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
binding
cofactor binding
catalytic activity
pyridoxal phosphate binding
carbon-sulfur lyase activity
cystathionine beta-lyase activity
lyase activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFR055W
Gene Sequence>1023 bp ATGTCTACAGACAAGATCACATTTTTGTTGAACTGGCAACCAACCCCATACCATATTCCA ATTTTCTTGGCTCAAACCAAAGGTTACTTCAAGGAGCAAGGTCTAGACATGGCCATCCTA GAACCAACCAATCCTTCCGATGTCACTGAGTTAATTGGATCTGGTAAGGTCGACATGGGT TTGAAAGCCATGATCCACACCTTGGCTGCCAAGGCCCGTGGTTTCCCAGTGACCTCTGTT GCCTCTTTGTTGGACGAACCATTTACCGGTGTCTTGTACTTAAAGGGCAGTGGTATCACT GAAGACTTCCAGTCCCTAAAGGGTAAGAAGATCGGTTACGTTGGTGAATTCGGTAAGATC CAAATCGATGAATTGACCAAGCACTACGGTATGAAGCCAGAAGACTACACCGCCGTCAGA TGTGGTATGAATGTCGCCAAGTACATCATCGAAGGTAAGATTGATGCCGGTATTGGTATC GAATGTATGCAACAAGTCGAATTGGAAGAGTACTTGGCCAAGCAAGGCAGACCAGCTTCT GATGCTAAAATGTTGAGAATTGACAAGTTGGCTTGCTTGGGTTGCTGTTGCTTCTGTACC GTTCTTTACATCTGCAACGATGAATTTTTGAAGAAGAACCCTGAAAAGGTCAGAAAGTTC TTGAAAGCCATCAAGAAGGCAACCGACTACGTTCTAGCCGACCCTGTGAAGGCTTGGAAA GAATACATCGACTTCAAGCCTCAATTGAACAACGATCTATCCTACAAGCAATACCAAAGA TGTTACGCTTACTTCTCTTCATCTTTGTACAATGTTCACCGTGACTGGAAGAAGGTTACC GGTTACGGTAAGAGATTAGCCATCTTGCCACCAGACTATGTCTCGAACTACACTAATGAA TACTTGTCCTGGCCAGAACCAGAAGAGGTTTCTGATCCTTTGGAAGCTCAAAGATTGATG GCTATTCATCAAGAAAAATGCAGACAGGAAGGTACTTTCAAGAGATTGGCTCTTCCAGCT TAA
Protein Properties
Pfam Domain Function
Protein Residues340
Protein Molecular Weight36971.10156
Protein Theoretical pI6.05
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative cystathionine beta-lyase MIDRTELSKFGITTQLSVIGRNPDEQSGFVNPPLYKGSTIILKKLSDLEQRKGRFYGTAG SPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVYVPTRMLCDG LLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVSVAKKHGIKT ILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIGLASANEECWPLLRSTYDAMAM LPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGNRDEVEKVLHPAFEDCPGHEYWVR DYKGSSGLFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGG
References
External Links
ResourceLink
Saccharomyces Genome Database IRC7
Uniprot IDP43623
Uniprot NameMETC_YEAST
GenBank Gene IDD50617
Genebank Protein ID836697
General Reference
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Eki, T., Naitou, M., Hagiwara, H., Ozawa, M., Sasanuma, S. I., Sasanuma, M., Tsuchiya, Y., Shibata, T., Hanaoka, F., Murakami, Y. (1996). "Analysis of a 36.2 kb DNA sequence including the right telomere of chromosome VI from Saccharomyces cerevisiae." Yeast 12:149-167.8686379
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106