You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlanine--glyoxylate aminotransferase 1
SynonymsNot Available
Gene NameAGX1
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionHas alanine:glyoxylate aminotransferase activity
Cellular LocationNot Available
SMPDB Pathways
glycine metabolismPW002398 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Glycine, serine and threonine metabolismec00260 Map00260
SMPDB Reactions
Glyoxylic acid + L-AlaninePyruvic acid + Glycine
KEGG Reactions
Glyoxylic acid + L-AlaninePyruvic acid + Glycine
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00033Glyoxylic acidShow
YMDB00154L-AlanineShow
YMDB00175Pyruvic acidShow
GO Classification
Component
Not Available
Function
cofactor binding
pyridoxal phosphate binding
catalytic activity
binding
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFL030W
Gene Sequence>1158 bp ATGACTAAATCTGTAGATACGCTGCTGATCCCAGGCCCCATTATCCTAAGCGGAGCAGTC CAGAAGGCCCTGGACGTTCCCTCTTTGGGCCACACCTCTCCTGAGTTCGTCTCTATTTTT CAAAGGGTGCTAAAGAACACAAGAGCTGTCTTCAAATCCGCTGCTGCCTCGAAGTCTCAG CCTTTTGTGCTTGCCGGCTCTGGTACGTTGGGGTGGGACATATTTGCCTCGAACTTTATT CTTTCGAAGGCCCCCAACAAGAACGTGCTGGTCGTATCCACTGGGACATTTTCTGACAGG TTTGCTGACTGTCTGCGTAGCTACGGTGCGCAAGTAGATGTTGTTAGGCCCCTCAAGATA GGCGAATCAGTTCCCTTAGAACTGATTACTGAAAAGTTGTCGCAAAATAGCTATGGGGCT GTCACGGTTACGCACGTTGACACTTCAACGGCAGTGCTGTCCGATCTGAAAGCCATTTCG CAAGCGATTAAGCAGACTTCGCCGGAAACGTTCTTCGTAGTCGATGCTGTATGCTCGATT GGATGCGAAGAGTTTGAATTTGATGAATGGGGGGTGGATTTCGCCTTGACTGCTTCGCAA AAGGCTATTGGCGCTCCAGCGGGTCTTTCTATCTCGCTATGCAGTAGCAGATTCATGGAT TATGCACTCAACGACAGCAAAAATGGTCATGTACATGGGTATTTTTCCTCGTTGAGAAGA TGGACACCAATAATGGAAAATTATGAGGCTGGTAAAGGAGCTTATTTTGCAACCCCACCC GTACAACTAATTAATAGCCTTGATGTAGCCTTGAAAGAAATTCTCGAAGAGGGGTTGCAT AAGAGATGGGATTTGCACCGTGAAATGAGTGATTGGTTTAAAGACAGTTTGGTTAATGGC TTGCAATTGACATCCGTCAGTAGGTATCCTTCTAACATGTCTGCGCACGGGTTGACAGCC GTATACGTAGCAGATCCTCCTGATGTCATTGCTTTTTTAAAGTCACACGGTGTAGTCATT GCCGGAGGTATTCACAAGGACATCGGACCCAAGTATATCCGTATTGGACATATGGGTGTG ACCGCTTGCAACAAGAATTTACCGTACATGAAGAACTGCTTCGACTTAATAAAACTAGCT CTTCAGAGGAAAAAGTGA
Protein Properties
Pfam Domain Function
Protein Residues385
Protein Molecular Weight41906.80078
Protein Theoretical pI8.14
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alanine--glyoxylate aminotransferase 1 MTKSVDTLLIPGPIILSGAVQKALDVPSLGHTSPEFVSIFQRVLKNTRAVFKSAAASKSQ PFVLAGSGTLGWDIFASNFILSKAPNKNVLVVSTGTFSDRFADCLRSYGAQVDVVRPLKI GESVPLELITEKLSQNSYGAVTVTHVDTSTAVLSDLKAISQAIKQTSPETFFVVDAVCSI GCEEFEFDEWGVDFALTASQKAIGAPAGLSISLCSSRFMDYALNDSKNGHVHGYFSSLRR WTPIMENYEAGKGAYFATPPVQLINSLDVALKEILEEGLHKRWDLHREMSDWFKDSLVNG LQLTSVSRYPSNMSAHGLTAVYVADPPDVIAFLKSHGVVIAGGIHKDIGPKYIRIGHMGV TACNKNLPYMKNCFDLIKLALQRKK
References
External Links
ResourceLink
Saccharomyces Genome Database AGX1
Uniprot IDP43567
Uniprot NameAGX1_YEAST
GenBank Gene IDD50617
Genebank Protein ID836724
General Reference
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Takada, Y., Noguchi, T. (1985). "Characteristics of alanine: glyoxylate aminotransferase from Saccharomyces cerevisiae, a regulatory enzyme in the glyoxylate pathway of glycine and serine biosynthesis from tricarboxylic acid-cycle intermediates." Biochem J 231:157-163.3933486
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Schlosser, T., Gatgens, C., Weber, U., Stahmann, K. P. (2004). "Alanine : glyoxylate aminotransferase of Saccharomyces cerevisiae-encoding gene AGX1 and metabolic significance." Yeast 21:63-73.14745783
  • Meyer, P., Liger, D., Leulliot, N., Quevillon-Cheruel, S., Zhou, C. Z., Borel, F., Ferrer, J. L., Poupon, A., Janin, J., van Tilbeurgh, H. (2005). "Crystal structure and confirmation of the alanine:glyoxylate aminotransferase activity of the YFL030w yeast protein." Biochimie 87:1041-1047.16226833