You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDihydroxyacetone kinase 2
Synonyms
  • DHA kinase 2
  • Glycerone kinase 2
Gene NameDAK2
Enzyme Class
Biological Properties
General FunctionInvolved in glycerone kinase activity
Specific FunctionATP + glycerone = ADP + glycerone phosphate
Cellular LocationNot Available
SMPDB Pathways
Glycerol metabolismPW002407 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerolipid metabolismec00561 Map00561
Methane metabolismec00680 Map00680
SMPDB Reactions
Dihydroxyacetone + Adenosine triphosphateGlycerone phosphate + ADP
KEGG Reactions
Dihydroxyacetone + Adenosine triphosphateDihydroxyacetone phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00018DihydroxyacetoneShow
YMDB00109Adenosine triphosphateShow
YMDB00322Dihydroxyacetone phosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB16273Glycerone phosphateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
glycerone kinase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
catalytic activity
kinase activity
transferase activity
Process
metabolic process
alcohol metabolic process
polyol metabolic process
alditol metabolic process
glycerol metabolic process
small molecule metabolic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFL053W
Gene Sequence>1776 bp ATGTCTCACAAACAATTCAAATCAGATGGAAACATCGTTACTCCCTACCTACTTGGCCTT GCTCGAAGCAATCCCGGCCTTACAGTGATTAAGCACGACAGAGTGGTTTTCCGGACTGCG TCAGCTCCTAATTCAGGGAACCCTCCTAAAGTTTCATTGGTTTCTGGAGGTGGCAGTGGT CATGAGCCAACGCATGCCGGTTTTGTTGGTGAAGGTGCCTTAGATGCGATTGCAGCAGGT GCCATTTTTGCTTCTCCTTCAACTAAACAGATCTATTCTGCTATTAAAGCTGTTGAATCT CCTAAGGGTACCTTGATCATTGTAAAAAATTACACCGGTGATATTATACATTTTGGTCTC GCTGCTGAAAGAGCTAAAGCTGCTGGAATGAAAGTCGAACTGGTTGCTGTAGGAGATGAT GTCTCTGTCGGTAAGAAGAAAGGTTCTTTAGTCGGGCGTCGAGGTCTCGGAGCCACCGTA TTGGTGCATAAAATTGCTGGGGCAGCCGCTTCTCATGGACTGGAGTTGGCAGAAGTTGCC GAAGTTGCTCAGTCAGTAGTTGACAATAGTGTCACAATTGCGGCATCTCTTGATCACTGC ACGGTTCCTGGCCACAAACCTGAAGCCATTTTGGGCGAGAATGAGTATGAAATCGGTATG GGTATTCATAACGAGTCTGGTACCTATAAGTCTTCTCCGCTGCCATCGATTTCTGAGCTC GTTTCCCAGATGCTTCCTCTTCTTCTCGATGAGGATGAAGACCGTTCTTATGTGAAGTTT GAGCCCAAAGAGGACGTAGTTCTTATGGTTAACAACATGGGTGGTATGTCTAATCTAGAA TTGGGTTATGCTGCAGAGGTCATTTCTGAACAATTGATTGATAAGTATCAAATTGTGCCC AAGAGAACGATTACTGGAGCATTCATTACTGCATTGAATGGTCCTGGGTTTGGTATCACT CTTATGAACGCTTCAAAAGCTGGTGGCGATATCCTTAAGTATTTCGATTATCCTACCACA GCGAGTGGATGGAATCAAATGTACCATTCTGCCAAAGATTGGGAGGTACTTGCCAAAGGG CAGGTTCCCACCGCCCCCTCTTTAAAGACATTGAGGAATGAAAAAGGTTCGGGTGTGAAA GCTGATTATGACACTTTTGCTAAAATTTTGCTTGCTGGGATTGCAAAAATTAACGAGGTT GAACCAAAGGTTACTTGGTACGATACCATTGCAGGAGATGGTGATTGCGGAACTACTCTT GTGTCCGGTGGTGAAGCATTGGAAGAAGCTATTAAAAACCATACGTTGCGCCTCGAGGAT GCTGCTCTTGGTATCGAAGATATTGCGTATATGGTTGAGGATTCTATGGGTGGTACGTCC GGTGGTCTGTACTCTATCTATCTTTCTGCTCTCGCACAAGGAGTTAGGGATTCTGGGGAC AAGGAACTTACTGCGGAAACTTTCAAAAAGGCATCAAACGTTGCACTAGATGCTTTGTAT AAGTATACGAGAGCCCGTCCTGGTTACAGGACTCTGATCGATGCTCTGCAACCTTTTGTC GAAGCGCTGAAAGCCGGGAAGGGTCCCAGAGCCGCCGCCCAAGCTGCTTATGATGGTGCC GAAAAGACAAGGAAGATGGATGCCCTTGTTGGGCGTGCTTCTTACGTGGCTAAGGAGGAG CTGAGAAAACTCGACAGCGAAGGTGGATTACCAGATCCAGGAGCAGTTGGTCTTGCTGCA CTACTCGATGGATTTGTTACAGCTGCTGGGTACTAG
Protein Properties
Pfam Domain Function
Protein Residues591
Protein Molecular Weight62134.0
Protein Theoretical pI5.67
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dihydroxyacetone kinase 2 MSHKQFKSDGNIVTPYLLGLARSNPGLTVIKHDRVVFRTASAPNSGNPPKVSLVSGGGSG HEPTHAGFVGEGALDAIAAGAIFASPSTKQIYSAIKAVESPKGTLIIVKNYTGDIIHFGL AAERAKAAGMKVELVAVGDDVSVGKKKGSLVGRRGLGATVLVHKIAGAAASHGLELAEVA EVAQSVVDNSVTIAASLDHCTVPGHKPEAILGENEYEIGMGIHNESGTYKSSPLPSISEL VSQMLPLLLDEDEDRSYVKFEPKEDVVLMVNNMGGMSNLELGYAAEVISEQLIDKYQIVP KRTITGAFITALNGPGFGITLMNASKAGGDILKYFDYPTTASGWNQMYHSAKDWEVLAKG QVPTAPSLKTLRNEKGSGVKADYDTFAKILLAGIAKINEVEPKVTWYDTIAGDGDCGTTL VSGGEALEEAIKNHTLRLEDAALGIEDIAYMVEDSMGGTSGGLYSIYLSALAQGVRDSGD KELTAETFKKASNVALDALYKYTRARPGYRTLIDALQPFVEALKAGKGPRAAAQAAYDGA EKTRKMDALVGRASYVAKEELRKLDSEGGLPDPGAVGLAALLDGFVTAAGY
References
External Links
ResourceLink
Saccharomyces Genome Database DAK2
Uniprot IDP43550
Uniprot NameDAK2_YEAST
GenBank Gene IDD50617
Genebank Protein ID836702
General Reference
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956