Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidylinositol 4-kinase LSB6
Synonyms
  • PI4-kinase
  • PtdIns-4-kinase
  • LAS seventeen-binding protein 6
  • LAS17-binding protein 6
Gene NameLSB6
Enzyme Class
Biological Properties
General FunctionInvolved in phosphotransferase activity, alcohol group as acceptor
Specific FunctionMay play a role in endocytic and/or exocytic pathways
Cellular LocationCell membrane; Peripheral membrane protein. Vacuole membrane; Peripheral membrane protein.
SMPDB Pathways
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + 1-Phosphatidyl-D-myo-inositol + hydron ↔ 1-phosphatidyl-1D-myo-inositol 4-phosphate + ADP
Adenosine triphosphate + 1-Phosphatidyl-D-myo-inositol ↔ 1-phosphatidyl-1D-myo-inositol 4-phosphate + ADP
Adenosine triphosphate + 1-Phosphatidyl-D-myo-inositol → 1-phosphatidyl-1D-myo-inositol 4-phosphate + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB002301-Phosphatidyl-D-myo-inositolShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
phosphotransferase activity, alcohol group as acceptor
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
Not Available
Gene Properties
Chromosome Locationchromosome 10
LocusYJL100W
Gene Sequence>1824 bp ATGAGTAACGAAGCTTACCAGCATGATCATACCGTAAATCCTCACCAGAAGATAGTTGTG AACAGCTACGATTGGTTACAGTTCCGTGATGAGCAAGATCACTGTAAAAGTAAGAACCCG ATAACGCACGCTTCTCCAGGGGTCGGTTCGAATGCACAGAATTCAGACATAGCGGAGGCC CCTCAGGTATTCCACCCTTCCTATCAATCTCTGGTCAACGTACCGTCCGAGAGCCCGCGA CCTGATCAGACTTCAGGGTCCAATCCTGCCGTTGGACTGCTTCATAATGCAGAGGACAAA GCGTCAGGGCAAGAAGAAGAAGGAAGTCAATATGAGATTCAATATTCGGTATTTCGTCCG CTGCATGCATATCCAACCAAGGGCCTAGCATATGAGCAGCTCCGAAGAAAAGAAGAACAA GAACAGAGGGAAAACTTCAACCATTTGGTTTCTGACTGTATTGAGGCTGTAGAGACATTT GGACGCGAACTCGAGAGAATCCAAACTGGCTCAAGTGGGTCGTACTTTGTGTATGGAACA CGGGCCGACGAAAGCGTTCCGGTGGGGGTCTTCAAGCCCAAGGATGAGGAACCATATGGC CCATTTTCTCCCAAATGGACCAAATGGGCACACCGCACGTTTTTCCCATGTCTGTTTGGC AGAAGTTGTCTGATTCCAAACCTCGGGTACATCTGTGAAAGTGCGGCTAGTTTGTTGGAT AGGCGACTGGAAACGCATCTAGTACCCTATACAGATACTGCATCTATAGAGTCTTTTAAT TTTTATGATAATAGAAAAAAATGGGTATTGGGATACAACCTTCAGAAGAAGAAACAAAAA AAGCTGGGTTCTTTCCAACTTTTTTTGAAGGAGTACATCAACGCCGATGAGTTCTTTCAT AAATACCCATTACCTGGGATGTATTCAGATGTTAAACATTCATTTCATCGTAAGTCATCC GGCGAAGATATCAATCATAAACCAGAGACAACCAGGAACCTAACAGATGAGACAGAACCG TCCAAGCAAATAAATTCCTCTCCAATTTCGACGGAATCTGAAGAAAATTCGAAATTTGAA TGGACAGAATCAAGTTTGAGTCAGTTCAGATTGGAACTAGAAAAACTAATTATCCTTGAT TATATAATGAGAAACACAGATAGAGGTCTAGACAATTGGATGGTGAAACTAATCAAACTT TCAAACAATAAGTGGAGACTCAAGTTAGCCGCCATCGACAATGGGTTGTCCTTTCCCTGG AAGCATCCTGATGAGTGGCGTCTGTACCCATATGGCTGGTTGTATTTGCCTCTGCAACTA CTAGCCAAACCATTTTCTGAGCAAATGAGATCTCATTTCCTACCGATATTGACAAGCACT AATTGGTGGGAAGAGTCGTACCAAGAATTCTTGGCCCTATTTAGCAGGGACCAAGATTTT AACGTCCGAATGTGGAAGAAGCAATGGGCAGTATTAAAAGGACAGGCGTTCAACGTTGTC GAAACATTGAAAGACCCACGACAAGGCCCCTTGGAATTGGTTAGAAGGACAAGGTGCCAG GTAATAGATGAGAAGATGCAAGTTCCCTGTTGCCCACCTCCAGTTTCTATTTTCAAAAAC GCCATAGACGAACCTATTGGATCATATTCCACTTCACCAATGGTACTCCCTAGCACCCCA AGCACAATTCCATTTCATGCACATAACCAAAGCAATAGTAATCCTGTATACTATGATTCC ACTCTGCACCCATTTGCTAATAAAACAGTGATAGCAGAGCGGCTACAAATAGTCAATTCC ACCCCCGTATTCACCTGGTGTTGA
Protein Properties
Pfam Domain Function
Protein Residues607
Protein Molecular Weight70216.39844
Protein Theoretical pI6.68
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphatidylinositol 4-kinase LSB6 MSNEAYQHDHTVNPHQKIVVNSYDWLQFRDEQDHCKSKNPITHASPGVGSNAQNSDIAEA PQVFHPSYQSLVNVPSESPRPDQTSGSNPAVGLLHNAEDKASGQEEEGSQYEIQYSVFRP LHAYPTKGLAYEQLRRKEEQEQRENFNHLVSDCIEAVETFGRELERIQTGSSGSYFVYGT RADESVPVGVFKPKDEEPYGPFSPKWTKWAHRTFFPCLFGRSCLIPNLGYICESAASLLD RRLETHLVPYTDTASIESFNFYDNRKKWVLGYNLQKKKQKKLGSFQLFLKEYINADEFFH KYPLPGMYSDVKHSFHRKSSGEDINHKPETTRNLTDETEPSKQINSSPISTESEENSKFE WTESSLSQFRLELEKLIILDYIMRNTDRGLDNWMVKLIKLSNNKWRLKLAAIDNGLSFPW KHPDEWRLYPYGWLYLPLQLLAKPFSEQMRSHFLPILTSTNWWEESYQEFLALFSRDQDF NVRMWKKQWAVLKGQAFNVVETLKDPRQGPLELVRRTRCQVIDEKMQVPCCPPPVSIFKN AIDEPIGSYSTSPMVLPSTPSTIPFHAHNQSNSNPVYYDSTLHPFANKTVIAERLQIVNS TPVFTWC
References
External Links
ResourceLink
Saccharomyces Genome Database LSB6
Uniprot IDP42951
Uniprot NameLSB6_YEAST
GenBank Gene IDX85021
Genebank Protein ID728710
General Reference
  • Rasmussen, S. W. (1995). "A 37.5 kb region of yeast chromosome X includes the SME1, MEF2, GSH1 and CSD3 genes, a TCP-1-related gene, an open reading frame similar to the DAL80 gene, and a tRNA(Arg)." Yeast 11:873-883.7483851
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Han, G. S., Audhya, A., Markley, D. J., Emr, S. D., Carman, G. M. (2002). "The Saccharomyces cerevisiae LSB6 gene encodes phosphatidylinositol 4-kinase activity." J Biol Chem 277:47709-47718.12361950
  • Shelton, S. N., Barylko, B., Binns, D. D., Horazdovsky, B. F., Albanesi, J. P., Goodman, J. M. (2003). "Saccharomyces cerevisiae contains a Type II phosphoinositide 4-kinase." Biochem J 371:533-540.12523934
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106