You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameN6-adenosine-methyltransferase IME4
SynonymsNot Available
Gene NameIME4
Enzyme Class
Biological Properties
General FunctionInvolved in methyltransferase activity
Specific FunctionN6-methyltransferase that methylates adenosine residues of some mRNAs and is essential to activate sporulation. N6- methyladenosine (m6A), which is present at internal sites of some mRNAs, is probably required to initiate sporulation. Positive regulator for IME2
Cellular LocationNucleus (Probable)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL192W
Gene Sequence>1803 bp ATGATTAACGATAAACTAGTACATTTTCTGATCCAGAATTATGATGACATCCTAAGAGCA CCGCTTTCTGGACAGCTCAAAGATGTGTATTCACTGTACATCAGTGGCGGATACGATGAT GAGATGCAGAAGTTGAGAAACGATAAAGACGAGGTCTTACAGTTTGAACAGTTTTGGAAT GATCTTCAGGATATTATATTTGCAACGCCGCAGTCCATTCAATTTGACCAGAATCTATTA GTGGCAGATAGGCCAGAAAAAATTGTTTACCTGGACGTTTTTTCCTTGAAAATTCTCTAT AACAAGTTCCATGCCTTCTACTATACATTAAAATCGTCCAGTTCTTCATGTGAAGAAAAA GTGTCGAGTTTAACAACAAAACCGGAAGCTGATTCGGAAAAAGACCAACTGCTGGGTAGA CTGCTTGGAGTCCTGAACTGGGACGTTAACGTCAGCAACCAGGGGTTACCACGTGAACAA CTGAGCAATCGCTTACAAAATTTATTGAGGGAAAAACCATCATCTTTTCAGCTTGCTAAA GAAAGAGCCAAATACACGACCGAGGTCATTGAATACATCCCGATATGTAGTGACTATTCG CATGCATCTCTATTGTCCACCTCGGTGTACATTGTCAATAACAAAATCGTTTCTTTACAA TGGTCCAAAATATCCGCATGTCAGGAAAATCACCCAGGATTAATTGAGTGCATTCAATCA AAAATTCACTTTATCCCTAATATCAAACCACAAACTGATATTTCGTTAGGAGATTGTTCC TATTTGGATACCTGTCATAAATTAAATACGTGTCGATACATTCATTACCTGCAATATATT CCGTCATGCTTGCAAGAGCGAGCTGATCGTGAAACTGCGAGTGAAAATAAAAGAATACGG TCAAACGTTTCCATTCCATTTTATACTCTGGGCAATTGCTCCGCACATTGTATCAAAAAG GCTTTACCTGCACAGTGGATCCGTTGCGATGTGCGGAAATTTGATTTTAGGGTTCTTGGA AAGTTTTCGGTAGTTATTGCAGATCCTGCATGGAATATCCATATGAACCTACCATACGGT ACTTGCAACGATATTGAACTATTAGGTTTGCCTTTGCACGAACTACAAGATGAAGGTATT ATTTTTCTTTGGGTGACGGGTAGAGCTATAGAATTGGGTAAAGAGTCTTTGAATAACTGG GGTTACAACGTGATAAATGAAGTTTCATGGATAAAGACAAACCAACTGGGTAGAACAATT GTTACAGGTCGTACGGGTCATTGGTTAAATCATTCTAAGGAGCATTTATTGGTGGGCTTA AAGGGTAATCCAAAGTGGATCAACAAACATATTGACGTCGATTTGATCGTATCAATGACC AGAGAGACTAGTAGAAAGCCTGATGAACTGTATGGTATAGCAGAACGGTTGGCAGGCACC CATGCCAGAAAACTAGAGATATTCGGAAGGGATCACAATACGCGGCCTGGCTGGTTTACC ATCGGAAACCAGTTGACAGGAAATTGCATTTACGAAATGGATGTCGAGAGGAAGTACCAG GAGTTTATGAAGAGCAAAACTGGAACCAGCCACACTGGTACTAAAAAAATCGACAAAAAG CAACCTTCAAAATTACAGCAGCAGCATCAGCAGCAGTATTGGAATAATATGGATATGGGG AGTGGTAAGTATTATGCTGAGGCCAAGCAGAATCCTATGAATCAAAAACATACTCCCTTT GAATCCAAACAGCAACAAAAACAACAATTCCAAACACTAAATAACCTATATTTTGCTCAG TAA
Protein Properties
Pfam Domain Function
Protein Residues600
Protein Molecular Weight69395.39844
Protein Theoretical pI8.12
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>N6-adenosine-methyltransferase IME4 MINDKLVHFLIQNYDDILRAPLSGQLKDVYSLYISGGYDDEMQKLRNDKDEVLQFEQFWN DLQDIIFATPQSIQFDQNLLVADRPEKIVYLDVFSLKILYNKFHAFYYTLKSSSSSCEEK VSSLTTKPEADSEKDQLLGRLLGVLNWDVNVSNQGLPREQLSNRLQNLLREKPSSFQLAK ERAKYTTEVIEYIPICSDYSHASLLSTSVYIVNNKIVSLQWSKISACQENHPGLIECIQS KIHFIPNIKPQTDISLGDCSYLDTCHKLNTCRYIHYLQYIPSCLQERADRETASENKRIR SNVSIPFYTLGNCSAHCIKKALPAQWIRCDVRKFDFRVLGKFSVVIADPAWNIHMNLPYG TCNDIELLGLPLHELQDEGIIFLWVTGRAIELGKESLNNWGYNVINEVSWIKTNQLGRTI VTGRTGHWLNHSKEHLLVGLKGNPKWINKHIDVDLIVSMTRETSRKPDELYGIAERLAGT HARKLEIFGRDHNTRPGWFTIGNQLTGNCIYEMDVERKYQEFMKSKTGTSHTGTKKIDKK QPSKLQQQHQQQYWNNMDMGSGKYYAEAKQNPMNQKHTPFESKQQQKQQFQTLNNLYFAQ
References
External Links
ResourceLink
Saccharomyces Genome Database IME4
Uniprot IDP41833
Uniprot NameIME4_YEAST
GenBank Gene IDD23721
Genebank Protein ID471168
General Reference
  • Shah, J. C., Clancy, M. J. (1992). "IME4, a gene that mediates MAT and nutritional control of meiosis in Saccharomyces cerevisiae." Mol Cell Biol 12:1078-1086.1545790
  • Coglievina, M., Klima, R., Bertani, I., Delneri, D., Zaccaria, P., Bruschi, C. V. (1997). "Sequencing of a 40.5 kb fragment located on the left arm of chromosome VII from Saccharomyces cerevisiae." Yeast 13:55-64.9046087
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Clancy, M. J., Shambaugh, M. E., Timpte, C. S., Bokar, J. A. (2002). "Induction of sporulation in Saccharomyces cerevisiae leads to the formation of N6-methyladenosine in mRNA: a potential mechanism for the activity of the IME4 gene." Nucleic Acids Res 30:4509-4518.12384598