You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADPH dehydrogenase 3
Synonyms
  • Old yellow enzyme 3
Gene NameOYE3
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionOxidizes beta-NADH, beta-NADPH, and alpha-NADPH
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00812acroleinShow
YMDB00862hydronShow
YMDB00911PropanalShow
GO Classification
Component
Not Available
Function
nucleotide binding
FMN binding
oxidoreductase activity
catalytic activity
binding
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL171C
Gene Sequence>1203 bp ATGCCATTTGTAAAAGGTTTTGAGCCGATCTCCCTAAGAGACACAAACCTTTTTGAACCA ATTAAGATTGGTAACACTCAGCTTGCACATCGTGCGGTTATGCCCCCATTGACCAGAATG AGGGCCACTCACCCCGGAAATATTCCAAATAAGGAGTGGGCTGCTGTGTATTATGGTCAG CGTGCTCAAAGACCTGGTACCATGATCATCACGGAAGGTACGTTTATTTCCCCTCAAGCC GGCGGCTATGACAACGCCCCTGGGATTTGGTCTGATGAGCAGGTCGCTGAGTGGAAGAAT ATCTTTTTAGCCATCCATGATTGTCAGTCGTTCGCGTGGGTACAACTTTGGTCTTTAGGC TGGGCATCCTTCCCAGACGTATTGGCAAGAGACGGGTTACGCTATGACTGTGCATCTGAC AGAGTGTATATGAATGCTACGTTACAAGAAAAGGCCAAAGATGCGAATAATCTCGAACAT AGTTTGACTAAAGACGACATTAAACAGTATATCAAGGATTACATCCATGCGGCTAAGAAT TCTATCGCGGCTGGCGCCGATGGTGTAGAAATTCATAGCGCCAATGGGTACTTGTTGAAT CAGTTCTTGGATCCACATTCTAATAAGAGGACCGACGAATACGGCGGAACGATCGAAAAC AGGGCCCGCTTTACACTGGAGGTTGTCGATGCTCTTATCGAAACTATCGGTCCTGAACGG GTGGGTTTGAGGTTGTCGCCGTACGGCACTTTTAACAGTATGTCTGGGGGTGCTGAACCA GGTATTATCGCTCAATATTCGTATGTTTTGGGTGAATTAGAGAAGAGGGCAAAGGCTGGT AAGCGTTTGGCCTTTGTGCACCTCGTTGAACCACGTGTCACGGACCCATCGTTGGTGGAG GGCGAAGGAGAATATTCCGAGGGTACTAACGATTTTGCCTACTCTATATGGAAGGGTCCA ATCATCAGAGCTGGTAATTACGCTCTTCATCCAGAAGTGGTTAGAGAACAAGTAAAGGAT CCCAGAACCTTGATAGGCTATGGTAGATTCTTCATCTCTAACCCAGATTTAGTCTACCGT TTAGAAGAGGGCCTGCCATTGAACAAGTATGACAGAAGTACCTTCTACACCATGTCCGCG GAAGGTTATACCGACTACCCAACATATGAAGAGGCAGTAGATTTAGGTTGGAACAAGAAC TGA
Protein Properties
Pfam Domain Function
Protein Residues400
Protein Molecular Weight44920.10156
Protein Theoretical pI5.31
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NADPH dehydrogenase 3 MPFVKGFEPISLRDTNLFEPIKIGNTQLAHRAVMPPLTRMRATHPGNIPNKEWAAVYYGQ RAQRPGTMIITEGTFISPQAGGYDNAPGIWSDEQVAEWKNIFLAIHDCQSFAWVQLWSLG WASFPDVLARDGLRYDCASDRVYMNATLQEKAKDANNLEHSLTKDDIKQYIKDYIHAAKN SIAAGADGVEIHSANGYLLNQFLDPHSNKRTDEYGGTIENRARFTLEVVDALIETIGPER VGLRLSPYGTFNSMSGGAEPGIIAQYSYVLGELEKRAKAGKRLAFVHLVEPRVTDPSLVE GEGEYSEGTNDFAYSIWKGPIIRAGNYALHPEVVREQVKDPRTLIGYGRFFISNPDLVYR LEEGLPLNKYDRSTFYTMSAEGYTDYPTYEEAVDLGWNKN
References
External Links
ResourceLink
Saccharomyces Genome Database OYE3
Uniprot IDP41816
Uniprot NameOYE3_YEAST
GenBank Gene IDL29279
Genebank Protein ID460039
General Reference
  • Niino, Y. S., Chakraborty, S., Brown, B. J., Massey, V. (1995). "A new old yellow enzyme of Saccharomyces cerevisiae." J Biol Chem 270:1983-1991.7836424
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Purnelle, B., Coster, F., Goffeau, A. (1996). "The sequence of 55 kb on the left arm of yeast chromosome XVI identifies a small nuclear RNA, a new putative protein kinase and two new putative regulators." Yeast 12:1483-1492.8948103