You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAcetyl-CoA acetyltransferase
Synonyms
  • Acetoacetyl-CoA thiolase
  • Ergosterol biosynthesis protein 10
Gene NameERG10
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring acyl groups other than amino-acyl groups
Specific FunctionCatalyzes the formation of acetoacetyl-CoA in the biosynthesis of mevalonate, an intermediate required for the biosynthesis of sterols and nonsterol isoprenoids
Cellular LocationCytoplasm
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Fatty acid metabolismPW002460 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
Terpenoid backbone biosynthesisPW002485 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Butanoate metabolismec00650 Map00650
Fatty acid metabolismec00071 Map00071
Lysine degradationec00310 Map00310
Propanoate metabolismec00640 Map00640
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Acetyl-CoACoenzyme A + acetoacetyl-CoA
KEGG Reactions
Acetyl-CoAacetoacetyl-CoA + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
YMDB00529acetoacetyl-CoAShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL028W
Gene Sequence>1197 bp ATGTCTCAGAACGTTTACATTGTATCGACTGCCAGAACCCCAATTGGTTCATTCCAGGGT TCTCTATCCTCCAAGACAGCAGTGGAATTGGGTGCTGTTGCTTTAAAAGGCGCCTTGGCT AAGGTTCCAGAATTGGATGCATCCAAGGATTTTGACGAAATTATTTTTGGTAACGTTCTT TCTGCCAATTTGGGCCAAGCTCCGGCCAGACAAGTTGCTTTGGCTGCCGGTTTGAGTAAT CATATCGTTGCAAGCACAGTTAACAAGGTCTGTGCATCCGCTATGAAGGCAATCATTTTG GGTGCTCAATCCATCAAATGTGGTAATGCTGATGTTGTCGTAGCTGGTGGTTGTGAATCT ATGACTAACGCACCATACTACATGCCAGCAGCCCGTGCGGGTGCCAAATTTGGCCAAACT GTTCTTGTTGATGGTGTCGAAAGAGATGGGTTGAACGATGCGTACGATGGTCTAGCCATG GGTGTACACGCAGAAAAGTGTGCCCGTGATTGGGATATTACTAGAGAACAACAAGACAAT TTTGCCATCGAATCCTACCAAAAATCTCAAAAATCTCAAAAGGAAGGTAAATTCGACAAT GAAATTGTACCTGTTACCATTAAGGGATTTAGAGGTAAGCCTGATACTCAAGTCACGAAG GACGAGGAACCTGCTAGATTACACGTTGAAAAATTGAGATCTGCAAGGACTGTTTTCCAA AAAGAAAACGGTACTGTTACTGCCGCTAACGCTTCTCCAATCAACGATGGTGCTGCAGCC GTCATCTTGGTTTCCGAAAAAGTTTTGAAGGAAAAGAATTTGAAGCCTTTGGCTATTATC AAAGGTTGGGGTGAGGCCGCTCATCAACCAGCTGATTTTACATGGGCTCCATCTCTTGCA GTTCCAAAGGCTTTGAAACATGCTGGCATCGAAGACATCAATTCTGTTGATTACTTTGAA TTCAATGAAGCCTTTTCGGTTGTCGGTTTGGTGAACACTAAGATTTTGAAGCTAGACCCA TCTAAGGTTAATGTATATGGTGGTGCTGTTGCTCTAGGTCACCCATTGGGTTGTTCTGGT GCTAGAGTGGTTGTTACACTGCTATCCATCTTACAGCAAGAAGGAGGTAAGATCGGTGTT GCCGCCATTTGTAATGGTGGTGGTGGTGCTTCCTCTATTGTCATTGAAAAGATATGA
Protein Properties
Pfam Domain Function
Protein Residues398
Protein Molecular Weight41728.39844
Protein Theoretical pI7.46
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Acetyl-CoA acetyltransferase MSQNVYIVSTARTPIGSFQGSLSSKTAVELGAVALKGALAKVPELDASKDFDEIIFGNVL SANLGQAPARQVALAAGLSNHIVASTVNKVCASAMKAIILGAQSIKCGNADVVVAGGCES MTNAPYYMPAARAGAKFGQTVLVDGVERDGLNDAYDGLAMGVHAEKCARDWDITREQQDN FAIESYQKSQKSQKEGKFDNEIVPVTIKGFRGKPDTQVTKDEEPARLHVEKLRSARTVFQ KENGTVTAANASPINDGAAAVILVSEKVLKEKNLKPLAIIKGWGEAAHQPADFTWAPSLA VPKALKHAGIEDINSVDYFEFNEAFSVVGLVNTKILKLDPSKVNVYGGAVALGHPLGCSG ARVVVTLLSILQQEGGKIGVAAICNGGGGASSIVIEKI
References
External Links
ResourceLink
Saccharomyces Genome Database ERG10
Uniprot IDP41338
Uniprot NameTHIL_YEAST
GenBank Gene IDL20428
Genebank Protein ID311089
General Reference
  • Hiser, L., Basson, M. E., Rine, J. (1994). "ERG10 from Saccharomyces cerevisiae encodes acetoacetyl-CoA thiolase." J Biol Chem 269:31383-31389.7989303
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Kornblatt, J. A., Rudney, H. (1971). "Two forms of acetoacetyl coenzyme A thiolase in yeast. I. Separation and properties." J Biol Chem 246:4417-4423.5571829
  • Dimster-Denk, D., Rine, J. (1996). "Transcriptional regulation of a sterol-biosynthetic enzyme by sterol levels in Saccharomyces cerevisiae." Mol Cell Biol 16:3981-3989.8754796
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956