You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlanyl-tRNA synthetase, cytoplasmic
Synonyms
  • Alanine--tRNA ligase
  • AlaRS
Gene NameALA1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionCatalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction:alanine is first activated by ATP to form Ala- AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + L-Alanine + tRNA(Ala) → Adenosine monophosphate + Pyrophosphate + Ala-tRNA(Ala)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00154L-AlanineShow
YMDB00219PyrophosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
nucleic acid binding
adenyl nucleotide binding
alanine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
nucleoside binding
purine nucleoside binding
Process
alanyl-tRNA aminoacylation
metabolic process
cellular macromolecule metabolic process
macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
biosynthetic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
Gene Properties
Chromosome Locationchromosome 15
LocusYOR335C
Gene Sequence>2877 bp ATGACGATCGGTGATAAGCAAAAATGGACCGCTACTAATGTCCGTAATACCTTTCTAGAC TATTTCAAATCTAAAGAACACAAGTTTGTCAAATCCTCTCCAGTAGTTCCATTTGATGAT CCAACTTTACTTTTCGCTAATGCCGGTATGAACCAATACAAGCCTATCTTTTTAGGTACT GTCGATCCAGCTTCCGATTTCTACACCTTGAAAAGGGCTTACAACTCTCAAAAGTGTATC AGAGCTGGTGGTAAACACAACGATTTAGAAGATGTCGGTAAGGATTCTTATCATCATACC TTTTTTGAAATGCTGGGTAACTGGTCGTTTGGCGACTATTTCAAGAAGGAAGCTATTACT TACTCATGGACTTTGTTGACTGAAGTATACGGCATTCCAAAGGATAGCTTATACGTTACC TATTTTGAAGGTGATGAAAAGTTAGGCTTGGAACCTGATACTGAAGCCCGTGAACTATGG AAAAATGTTGGTGTTCCCGATGACCATATATTACCTGGTAATGCAAAGGACAACTTTTGG GAAATGGGTGACCAAGGCCCATGTGGTCCTTGTTCTGAAATTCACTACGATAGAATAGGT GGTAGAAATGCTGCTTCCTTGGTTAATATGGACGACCCTGATGTCTTGGAAGTTTGGAAT TTGGTTTTCATTCAATTCAACAGAGAACAAGACGGGTCTTTGAAGCCTTTACCTGCCAAG CATATCGACACAGGTATGGGGTTCGAAAGATTGGTTTCTGTTCTGCAAGATGTTAGATCT AACTATGATACCGATGTTTTCACACCTTTGTTCGAGCGTATCCAAGAAATCACTTCAGTT AGACCATATTCTGGCAATTTTGGTGAGAATGACAAGGACGGTATCGATACTGCCTACAGA GTTTTAGCTGATCATGTCCGTACATTGACTTTTGCCTTAGCTGACGGTGGCGTTCCAAAC AATGAAGGTAGAGGATATGTTTTGAGACGCATTCTAAGAAGAGGTGCCCGTTACGCCCGT AAATACATGAATTACCCAATCGGTAACTTTTTCTCCACTTTGGCTCCAACTTTAATTTCT CAGGTTCAAGATATCTTTCCCGAATTAGCCAAGGATCCTGCATTCCTCTTTGAAATCTTG GATGAAGAAGAAGCTTCTTTCGCTAAGACCTTGGATCGTGGTGAAAGACTATTTGAAAAA TATGCTTCTGCTGCTTCTAAGACTGAATCTAAGACTTTAGACGGTAAACAAGTTTGGAGA CTTTACGACACTTATGGTTTCCCAGTCGACTTGACTGAATTGATGGCTGAAGAACAAGGC TTGAAGATTGATGGACCCGGTTTCGAAAAGGCCAAACAAGAGTCATACGAAGCATCCAAA AGAGGTGGTAAGAGGACCAAAAGTGATTTGATTAAGTTAAACGTCCATGAATTATCCGAG TTGAACGATGCTAAGGTGCCCAAGACTAATGATGAATTCAAATACGGCAGCGCCAACGTC GAAGGTACCATTTTGAAACTGCATGACGGTACCAACTTTGTTGATGAGATCACTGAACCA GGTAAGAAGTACGGTATTATTTTGGATAAAACATGTTTCTACGCCGAACAAGGTGGTCAA GAATATGACACTGGTAAAATTGTTATTGATGACGCTGCTGAGTTTAATGTTGAAAATGTT CAATTGTATAACGGTTTTGTTTTCCACACCGGGTCTTTAGAAGAAGGTAAGTTGTCTGTC GGTGACAAGATTATCGCTTCATTCGATGAACTACGTCGATTCCCTATTAAGAACAATCAT ACTGGTACACATATCTTAAACTTTGCTCTGAAGGAAACTTTGGGTAATGATGTCGATCAA AAGGGTTCTTTGGTTGCCCCAGAAAAATTGAGATTCGATTTCTCTCATAAAAAGGCTGTG TCAAATGAAGAATTGAAAAAAGTTGAAGATATCTGTAATGAGCAAATTAAAGAAAACTTA CAAGTGTTTTACAAGGAAATTCCATTGGACTTGGCCAAATCCATTGATGGTGTTCGTGCT GTCTTTGGTGAGACTTACCCAGATCCAGTTCGTGTAGTTTCTGTTGGTAAGCCAATCGAA GAATTGTTGGCCAACCCAGCTAACGAAGAGTGGACCAAGTATTCTATTGAATTTTGCGGT GGTACCCATGTCAACAAGACAGGCGATATTAAATACTTCGTCATTTTAGAAGAGAGCGGT ATTGCAAAGGGTATCAGAAGAATTGTTGCTGTTACTGGAACTGAAGCCTTTGAAGCTCAA AGATTGGCTGAACAGTTTGCTGCTGATTTGGATGCTGCAGACAAGCTGCCGTTCTCTCCA ATCAAAGAAAAGAAGTTGAAGGAACTTGGTGTCAAACTTGGTCAACTTTCAATTTCTGTT ATCACAAAAAATGAACTGAAGCAGAAATTTAACAAAATTGAAAAAGCAGTGAAGGATGAA GTTAAGTCAAGGGCCAAAAAAGAAAACAAACAAACTCTTGATGAAGTGAAGACATTTTTG CAAACCAATGAGAATGCTCCATACCTAGTTAAATTCATTGATATTTCTCCAAATGCTAAA GCTATCACTGAAGCGATCAACTACATGAAATCCAATGATTCTGTCAAAGACAAGTCAATC TATTTATTGGCAGGTAATGACCCTGAAGGTCGTGTTGCTCACGGTTGTTACATCTCCAAT GCTGCTTTAGCCAAGGGTATTGATGGTTCTGCGCTTGCCAAAAAGGTGTCCAGTATCATC GGCGGTAAGGCTGGTGGTAAAGGTAATGTTTTCCAAGGTATGGGTGATAAACCAGCCGCT ATAAAGGATGCAGTTGATGATTTGGAAAGTTTGTTCAAGGAGAAGCTTTCCATTTAA
Protein Properties
Pfam Domain Function
Protein Residues958
Protein Molecular Weight107276.0
Protein Theoretical pI5.18
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alanyl-tRNA synthetase, cytoplasmic MTIGDKQKWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGT VDPASDFYTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIT YSWTLLTEVYGIPKDRLYVTYFEGDEKLGLEPDTEARELWKNVGVPDDHILPGNAKDNFW EMGDQGPCGPCSEIHYDRIGGRNAASLVNMDDPDVLEVWNLVFIQFNREQDGSLKPLPAK HIDTGMGFERLVSVLQDVRSNYDTDVFTPLFERIQEITSVRPYSGNFGENDKDGIDTAYR VLADHVRTLTFALADGGVPNNEGRGYVLRRILRRGARYARKYMNYPIGNFFSTLAPTLIS QVQDIFPELAKDPAFLFEILDEEEASFAKTLDRGERLFEKYASAASKTESKTLDGKQVWR LYDTYGFPVDLTELMAEEQGLKIDGPGFEKAKQESYEASKRGGKKDQSDLIKLNVHELSE LNDAKVPKTNDEFKYGSANVEGTILKLHDGTNFVDEITEPGKKYGIILDKTCFYAEQGGQ EYDTGKIVIDDAAEFNVENVQLYNGFVFHTGSLEEGKLSVGDKIIASFDELRRFPIKNNH TGTHILNFALKETLGNDVDQKGSLVAPEKLRFDFSHKKAVSNEELKKVEDICNEQIKENL QVFYKEIPLDLAKSIDGVRAVFGETYPDPVRVVSVGKPIEELLANPANEEWTKYSIEFCG GTHVNKTGDIKYFVILEESGIAKGIRRIVAVTGTEAFEAQRLAEQFAADLDAADKLPFSP IKEKKLKELGVKLGQLSISVITKNELKQKFNKIEKAVKDEVKSRAKKENKQTLDEVKTFF ETNENAPYLVKFIDISPNAKAITEAINYMKSNDSVKDKSIYLLAGNDPEGRVAHGCYISN AALAKGIDGSALAKKVSSIIGGKAGGKGNVFQGMGDKPAAIKDAVDDLESLFKEKLSI
References
External Links
ResourceLink
Saccharomyces Genome Database ALA1
Uniprot IDP40825
Uniprot NameSYAC_YEAST
GenBank Gene IDU18672
Genebank Protein ID609338
General Reference
  • Parle-McDermott, A. G., Hand, N. J., Goulding, S. E., Wolfe, K. H. (1996). "Sequence of 29 kb around the PDR10 locus on the right arm of Saccharomyces cerevisiae chromosome XV: similarity to part of chromosome I." Yeast 12:999-1004.8896263
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956