You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUncharacterized mitochondrial carrier YIL006W
SynonymsNot Available
Gene NameNot Available
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionNot Available
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00110NADShow
YMDB00261Guanosine monophosphateShow
YMDB00306deamido-NAD(+)Show
YMDB00412NAD(+)Show
YMDB00451dAMPShow
YMDB00506dGMPShow
GO Classification
Component
organelle inner membrane
mitochondrial inner membrane
cell part
membrane
organelle membrane
Function
binding
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome LocationNot Available
LocusYIL006W
Gene Sequence>1122 bp ATGACACAGACTGATAATCCTGTCCCCAACTGCGGTTTACTGCCCGAGCAGCAGTATTGC TCTGCAGACCATGAAGAGCCACTGTTGTTGCATGAAGAACAATTGATATTCCCTGATCAT TCCTCCCAACTGTCCTCAGCAGATATCATCGAGCCCATCAAGATGAACAGCAGTACTGAG TCAATTATAGGGACAACGCTGCGAAAGAAATGGGTACCACTATCCTCAACTCAGATCACA GCTCTTTCCGGCGCATTTGCTGGATTCTTATCAGGTGTGGCAGTATGTCCCCTCGATGTT GCCAAAACGCGATTGCAAGCACAAGGACTACAAACTAGGTTCGAGAACCCCTACTATAGG GGGATAATGGGGACATTAAGTACTATAGTAAGAGACGAAGGCCCGCGGGGCCTCTACAAA GGGCTGGTACCGATTGTCCTGGGCTACTTCCCAACCTGGATGATATACTTCTCCGTGTAT GAATTCAGCAAAAAGTTCTTTCACGGCATCTTCCCACAGTTTGATTTTGTTGCTCAGTCA TGTGCTGCAATCACGGCAGGCGCTGCATCTACCACCTTGACCAACCCAATCTGGGTTGTG AAGACAAGACTTATGCTGCAATCAAACCTCGGTGAGCACCCCACACATTACAAAGGCACT TTCGATGCATTCAGAAAGCTATTTTATCAGGAAGGGTTTAAAGCATTATATGCGGGGCTG GTCCCCTCATTATTAGGGCTATTTCATGTGGCTATCCATTTCCCTATATACGAAGATTTG AAGGTAAGATTTCACTGCTATTCTCGGGAGAACAACACCAACTCCATCAACTTGCAACGG TTGATCATGGCATCGTCCGTCTCTAAGATGATTGCATCAGCAGTAACATATCCGCACGAA ATTTTACGAACCAGAATGCAACTGAAATCAGATATACCAGATTCCATTCAACGACGTCTG TTCCCCCTCATTAAAGCAACTTATGCACAAGAGGGACTAAAGGGATTTTATTCTGGATTT ACTACTAACCTAGTACGAACCATTCCGGCCTCGGCAATCACTCTAGTGTCCTTTGAGTAT TTCAGAAACCGCCTAGAAAATATTAGCACTATGGTAATTTAA
Protein Properties
Pfam Domain Function
Protein Residues373
Protein Molecular Weight41954.0
Protein Theoretical pI8.83
Signalling Regions
  • None
Transmembrane Regions
  • 81-101
  • 142-162
  • 177-199
  • 236-256
  • 281-297
  • 336-358
Protein Sequence>Uncharacterized mitochondrial carrier YIL006W MTQTDNPVPNCGLLPEQQYCSADHEEPLLLHEEQLIFPDHSSQLSSADIIEPIKMNSSTE SIIGTTLRKKWVPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYR GIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQS CAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGL VPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHE ILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEY FRNRLENISTMVI
References
External Links
ResourceLink
Saccharomyces Genome Database YIL006W
Uniprot IDP40556
Uniprot NameYIA6_YEAST
GenBank Gene IDZ38113
Genebank Protein ID558398
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258