You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADPH-dependent 1-acyldihydroxyacetone phosphate reductase
Synonyms
  • ADR
  • 1-acyl DHAP reductase
  • Acyl/alkyl DHAP reductase
  • Acylglycerone-phosphate reductase
Gene NameAYR1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCan convert acyl and alkyl dihydroxyacetone-phosphate (DHAP) into glycerolipids and ether lipids, respectively. Required for the biosynthesis of phosphatidic acid via the DHAP pathway, where it reduces 1-acyl DHAP to lysophosphatidic acid (LPA). Required for spore germination
Cellular LocationLipid droplet. Endoplasmic reticulum
SMPDB Pathways
Ether lipid metabolismPW002492 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerol metabolismPW002407 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Ether lipid metabolismec00565 Map00565
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
1-oleoyl-2-lyso-glycerone phosphate + hydron + NADPH1-oleyl-2-lyso-phosphatidate + NADP
1-palmitoylglycerone 3-phosphate + NADPH + hydronPA(16:0/0:0) + NADP
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB001871-palmitoylglycerone 3-phosphateShow
YMDB00259LPA(16:0/0:0)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB01160PA(16:0/0:0)Show
YMDB163021-oleyl-2-lyso-phosphatidateShow
YMDB163031-oleoyl-2-lyso-glycerone phosphateShow
GO Classification
Component
Not Available
Function
binding
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL124W
Gene Sequence>894 bp ATGTCGGAGTTACAGTCACAACCTAAAAAGATTGCCGTTGTTACAGGCGCCTCAGGTGGT ATTGGATATGAGGTAACGAAGGAATTAGCCAGAAATGGCTATTTGGTTTATGCATGTGCA AGAAGACTAGAACCAATGGCACAATTGGCCATCCAATTTGGTAACGATAGTATCAAACCA TATAAGTTGGATATTTCCAAGCCAGAAGAAATTGTAACATTTTCTGGTTTTTTGCGAGCT AATTTACCTGATGGTAAATTAGATTTATTGTACAACAATGCCGGTCAGAGTTGTACATTC CCTGCATTGGATGCAACAGATGCTGCAGTAGAACAATGCTTTAAGGTCAATGTGTTTGGT CATATCAACATGTGCCGTGAATTGTCGGAGTTCCTTATTAAAGCGAAAGGAACCATTGTC TTCACTGGTTCCTTGGCAGGAGTTGTGTCATTCCCCTTTGGTAGCATTTATTCCGCTTCT AAAGCTGCTATCCACCAATATGCTCGTGGGTTACATCTAGAGATGAAGCCCTTCAACGTG AGAGTGATTAACGCTATTACTGGCGGTGTGGCTACTGATATCGCTGATAAAAGGCCCTTG CCTGAAACCTCAATATACAACTTCCCTGAAGGTAGGGAAGCTTTTAATTCAAGAAAAACC ATGGCTAAGGACAATAAGCCCATGCCAGCTGATGCGTACGCAAAGCAACTGGTTAAAGAT ATCTTGAGCACTAGTGACCCTGTAGATGTTTATAGAGGAACGTTCGCCAACATCATGCGT TTTGTCATGATATTTGTTCCTTACTGGCTATTGGAAAAAGGACTTTCCAAAAAATTTAAA TTGGACAAAGTTAATAATGCTTTGAAGTCGAAACAGAAGAATAAGGACGATTAG
Protein Properties
Pfam Domain Function
Protein Residues297
Protein Molecular Weight32813.60156
Protein Theoretical pI9.61
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NADPH-dependent 1-acyldihydroxyacetone phosphate reductase MSELQSQPKKIAVVTGASGGIGYEVTKELARNGYLVYACARRLEPMAQLAIQFGNDSIKP YKLDISKPEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAAVEQCFKVNVFG HINMCRELSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFNV RVINAITGGVATDIADKRPLPETSIYNFPEGREAFNSRKTMAKDNKPMPADAYAKQLVKD ILSTSDPVDVYRGTFANIMRFVMIFVPYWLLEKGLSKKFKLDKVNNALKSKQKNKDD
References
External Links
ResourceLink
Saccharomyces Genome Database AYR1
Uniprot IDP40471
Uniprot NameAYR1_YEAST
GenBank Gene IDZ46833
Genebank Protein ID599993
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Racenis, P. V., Lai, J. L., Das, A. K., Mullick, P. C., Hajra, A. K., Greenberg, M. L. (1992). "The acyl dihydroxyacetone phosphate pathway enzymes for glycerolipid biosynthesis are present in the yeast Saccharomyces cerevisiae." J Bacteriol 174:5702-5710.1512203
  • Athenstaedt, K., Zweytick, D., Jandrositz, A., Kohlwein, S. D., Daum, G. (1999). "Identification and characterization of major lipid particle proteins of the yeast Saccharomyces cerevisiae." J Bacteriol 181:6441-6448.10515935
  • Athenstaedt, K., Daum, G. (2000). "1-Acyldihydroxyacetone-phosphate reductase (Ayr1p) of the yeast Saccharomyces cerevisiae encoded by the open reading frame YIL124w is a major component of lipid particles." J Biol Chem 275:235-240.10617610
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956