You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphofructo-2-kinase 1
Synonyms
  • 6PF-2-K 1
  • Phosphofructokinase 2 I
Gene NamePFK26
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionSynthesis of fructose 2,6-bisphosphate
Cellular LocationNot Available
SMPDB Pathways
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
β-D-fructofuranose 6-phosphate + Adenosine triphosphateADP + hydron + D-Fructose 2,6-bisphosphate
KEGG Reactions
Adenosine triphosphate + Fructose 6-phosphateD-Fructose 2,6-bisphosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00011D-Fructose 2,6-bisphosphateShow
YMDB00078Fructose 6-phosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB16262β-D-fructofuranose 6-phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
phosphofructokinase activity
transferase activity
6-phosphofructo-2-kinase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
phosphotransferase activity, alcohol group as acceptor
Process
hexose metabolic process
metabolic process
fructose metabolic process
fructose 2,6-bisphosphate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL107C
Gene Sequence>2484 bp ATGTTCAAACCAGTAGACTTCTCTGAAACATCTCCTGTGCCGCCTGATATTGATCTTGCT CCTACACAATCTCCACACCATGTGGCACCTAGTCAAGACTCCAGTTATGATCTTTTATCC CGGAGTTCCGATGATAAAATTGATGCTGAAAAGGGTCCGCATGATGAATTATCTAAGCAC TTACCACTTTTTCAGAAAAGACCTTTGAGCGATACTCCTATATCGAGCAATTGGAACTCT CCTGGAATCACTGAAGAAAATACACCTTCTGACTCTCCTGAAAATAGCGCTACTAATTTG AAATCGCTACATCGATTGCATATTAACGACGAAACGCAACTAAAAAATGCTAAAATTCCC ACAAACGATACTACTGACTACATGCCTCCTTCAGATGGAGCAAATGAGGTAACTCGGATT GATTTGAAAGACATTAAATCACCTACGAGACACCATAAAAGAAGACCTACCACCATCGAT GTTCCTGGTTTAACAAAGTCTAAAACATCTCCAGATGGTCTCATATCAAAGGAAGATAGT GGATCAAAGTTAGTGATTGTCATGGTCGGACTGCCAGCTACGGGAAAGTCATTTATTACA AATAAATTATCCAGATTTTTAAATTATTCTTTATACTATTGTAAAGTGTTTAATGTCGGT AACACTAGAAGGAAGTTTGCTAAGGAGCATGGCCTAAAGGACCAGGATTCAAAGTTTTTC GAGCCGAAAAACGCCGACTCTACTAGGTTGAGAGACAAATGGGCCATGGATACTCTGGAT GAATTGCTAGATTATTTATTAGAAGGTTCAGGATCTGTGGGAATTTTTGATGCTACAAAT ACCTCTCGTGAAAGAAGAAAAAACGTTCTGGCTAGAATCAGAAAGAGAAGTCCTCATTTG AAGGTTTTATTTTTAGAATCTGTTTGTTCGGATCATGCACTGGTACAGAAAAATATTAGA CTCAAATTATTTGGTCCAGATTACAAAGGTAAAGATCCTGAAAGCTCTTTAAAAGATTTT AAAAGTCGCCTGGCAAACTACTTGAAAGCCTATGAACCAATTGAGGATGACGAAAATTTG CAGTACATCAAAATGATAGATGTGGGAAAGAAAGTCATCGCATACAATATTCAAGGGTTT TTAGCTTCGCAGACGGTATATTATTTATTAAATTTCAATTTGGCTGACAGACAAATTTGG ATAACGAGAAGTGGCGAGAGCGAAGATAATGTTAGTGGCCGTATAGGCGGAAATTCCCAT TTGACTCCTCGTGGTCTAAGATTTGCTAAAAGTCTACCAAAATTCATTGCCAGACAGAGA GAAATATTTTATCAAAATCTCATGCAACAAAAAAAGAATAATGAAAATACAGATGGGAAC ATTTATAATGACTTTTTCGTTTGGACCAGCATGCGTGCTAGGACTATAGGGACTGCTCAA TATTTCAACGAAGATGATTATCCTATCAAACAAATGAAAATGTTAGATGAGTTAAGTGCA GGTGATTATGATGGTATGACATATCCAGAAATTAAAAACAACTTTCCTGAAGAATTCGAA AAAAGACAGAAAGATAAGTTGAGATACAGATACCCTGGTATTGGCGGTGAATCGTATATG GACGTTATTAATAGACTCAGACCTGTTATCACAGAACTAGAAAGAATCGAGGATAACGTT CTTATTATTACACACCGGGTGGTGGCAAGAGCCTTATTGGGTTATTTTATGAACTTGAGT ATGGGTATTATTGCCAATTTGGATGTCCCATTACATTGTGTATATTGCCTAGAACCAAAA CCATATGGAATCACTTGGTCATTATGGGAGTATGATGAAGCATCGGATTCATTTTCTAAG GTCCCACAAACGGACTTGAATACCACCAGAGTAAAGGAGGTTGGCCTTGTTTATAATGAA AGAAGATATTCTGTTATACCAACAGCTCCGCCAAGTGCAAGAAGCAGCTTTGCAAGTGAC TTTTTGTCAAGAAAAAGATCTAATCCTACTTCTGCATCTTCATCCCAGAGTGAATTATCA GAACAACCCAAGAATAGCGTTAGTGCTCAAACTGGCAGCAATAATACCACTCTCATTGGG AGCAACTTTAACATCAAGAATGAAAATGGTGATTCGAGAATACCATTATCTGCACCACTT ATGGCCACTAATACTTCTAATAACATCTTAGATGGTGGAGGTACCTCAATTTCGATACAT CGTCCCAGGGTTGTTCCAAATCAAAACAACGTGAATCCCCTTTTGGCTAACAACAATAAA GCGGCTTCTAATGTACCTAATGTAAAGAAGTCAGCGGCTACACCAAGGCAAATTTTTGAA ATAGATAAAGTGGACGAAAAGTTATCCATGTTGAAAAATAAAAGTTTTCTATTACATGGA AAGGATTATCCTAATAATGCTGATAATAATGACAACGAAGATATAAGGGCAAAAACCATG AATCGCAGCCAAAGTCACGTTTAA
Protein Properties
Pfam Domain Function
Protein Residues827
Protein Molecular Weight93416.20313
Protein Theoretical pI9.02
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphofructo-2-kinase 1 MFKPVDFSETSPVPPDIDLAPTQSPHHVAPSQDSSYDLLSRSSDDKIDAEKGPHDELSKH LPLFQKRPLSDTPISSNWNSPGITEENTPSDSPENSATNLKSLHRLHINDETQLKNAKIP TNDTTDYMPPSDGANEVTRIDLKDIKSPTRHHKRRPTTIDVPGLTKSKTSPDGLISKEDS GSKLVIVMVGLPATGKSFITNKLSRFLNYSLYYCKVFNVGNTRRKFAKEHGLKDQDSKFF EPKNADSTRLRDKWAMDTLDELLDYLLEGSGSVGIFDATNTSRERRKNVLARIRKRSPHL KVLFLESVCSDHALVQKNIRLKLFGPDYKGKDPESSLKDFKSRLANYLKAYEPIEDDENL QYIKMIDVGKKVIAYNIQGFLASQTVYYLLNFNLADRQIWITRSGESEDNVSGRIGGNSH LTPRGLRFAKSLPKFIARQREIFYQNLMQQKKNNENTDGNIYNDFFVWTSMRARTIGTAQ YFNEDDYPIKQMKMLDELSAGDYDGMTYPEIKNNFPEEFEKRQKDKLRYRYPGIGGESYM DVINRLRPVITELERIEDNVLIITHRVVARALLGYFMNLSMGIIANLDVPLHCVYCLEPK PYGITWSLWEYDEASDSFSKVPQTDLNTTRVKEVGLVYNERRYSVIPTAPPSARSSFASD FLSRKRSNPTSASSSQSELSEQPKNSVSAQTGSNNTTLIGSNFNIKNENGDSRIPLSAPL MATNTSNNILDGGGTSISIHRPRVVPNQNNVNPLLANNNKAASNVPNVKKSAATPRQIFE IDKVDEKLSMLKNKSFLLHGKDYPNNADNNDNEDIRAKTMNRSQSHV
References
External Links
ResourceLink
Saccharomyces Genome Database PFK26
Uniprot IDP40433
Uniprot Name6P21_YEAST
GenBank Gene IDAY692819
Genebank Protein ID51013089
General Reference
  • Kretschmer, M., Fraenkel, D. G. (1991). "Yeast 6-phosphofructo-2-kinase: sequence and mutant." Biochemistry 30:10663-10672.1657152
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kretschmer, M., Tempst, P., Fraenkel, D. G. (1991). "Identification and cloning of yeast phosphofructokinase 2." Eur J Biochem 197:367-372.1851090
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956