You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphofructo-2-kinase 1
Synonyms
  • 6PF-2-K 1
  • Phosphofructokinase 2 I
Gene NamePFK26
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionSynthesis of fructose 2,6-bisphosphate
Cellular LocationNot Available
SMPDB Pathways
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
β-D-fructofuranose 6-phosphate + Adenosine triphosphateADP + hydron + D-Fructose 2,6-bisphosphate
KEGG Reactions
Adenosine triphosphate + Fructose 6-phosphateD-Fructose 2,6-bisphosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00011D-Fructose 2,6-bisphosphateShow
YMDB00078Fructose 6-phosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB16262β-D-fructofuranose 6-phosphateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
phosphotransferase activity, alcohol group as acceptor
phosphofructokinase activity
catalytic activity
6-phosphofructo-2-kinase activity
transferase activity
Process
fructose 2,6-bisphosphate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
fructose metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL107C
Gene Sequence>2484 bp ATGTTCAAACCAGTAGACTTCTCTGAAACATCTCCTGTGCCGCCTGATATTGATCTTGCT CCTACACAATCTCCACACCATGTGGCACCTAGTCAAGACTCCAGTTATGATCTTTTATCC CGGAGTTCCGATGATAAAATTGATGCTGAAAAGGGTCCGCATGATGAATTATCTAAGCAC TTACCACTTTTTCAGAAAAGACCTTTGAGCGATACTCCTATATCGAGCAATTGGAACTCT CCTGGAATCACTGAAGAAAATACACCTTCTGACTCTCCTGAAAATAGCGCTACTAATTTG AAATCGCTACATCGATTGCATATTAACGACGAAACGCAACTAAAAAATGCTAAAATTCCC ACAAACGATACTACTGACTACATGCCTCCTTCAGATGGAGCAAATGAGGTAACTCGGATT GATTTGAAAGACATTAAATCACCTACGAGACACCATAAAAGAAGACCTACCACCATCGAT GTTCCTGGTTTAACAAAGTCTAAAACATCTCCAGATGGTCTCATATCAAAGGAAGATAGT GGATCAAAGTTAGTGATTGTCATGGTCGGACTGCCAGCTACGGGAAAGTCATTTATTACA AATAAATTATCCAGATTTTTAAATTATTCTTTATACTATTGTAAAGTGTTTAATGTCGGT AACACTAGAAGGAAGTTTGCTAAGGAGCATGGCCTAAAGGACCAGGATTCAAAGTTTTTC GAGCCGAAAAACGCCGACTCTACTAGGTTGAGAGACAAATGGGCCATGGATACTCTGGAT GAATTGCTAGATTATTTATTAGAAGGTTCAGGATCTGTGGGAATTTTTGATGCTACAAAT ACCTCTCGTGAAAGAAGAAAAAACGTTCTGGCTAGAATCAGAAAGAGAAGTCCTCATTTG AAGGTTTTATTTTTAGAATCTGTTTGTTCGGATCATGCACTGGTACAGAAAAATATTAGA CTCAAATTATTTGGTCCAGATTACAAAGGTAAAGATCCTGAAAGCTCTTTAAAAGATTTT AAAAGTCGCCTGGCAAACTACTTGAAAGCCTATGAACCAATTGAGGATGACGAAAATTTG CAGTACATCAAAATGATAGATGTGGGAAAGAAAGTCATCGCATACAATATTCAAGGGTTT TTAGCTTCGCAGACGGTATATTATTTATTAAATTTCAATTTGGCTGACAGACAAATTTGG ATAACGAGAAGTGGCGAGAGCGAAGATAATGTTAGTGGCCGTATAGGCGGAAATTCCCAT TTGACTCCTCGTGGTCTAAGATTTGCTAAAAGTCTACCAAAATTCATTGCCAGACAGAGA GAAATATTTTATCAAAATCTCATGCAACAAAAAAAGAATAATGAAAATACAGATGGGAAC ATTTATAATGACTTTTTCGTTTGGACCAGCATGCGTGCTAGGACTATAGGGACTGCTCAA TATTTCAACGAAGATGATTATCCTATCAAACAAATGAAAATGTTAGATGAGTTAAGTGCA GGTGATTATGATGGTATGACATATCCAGAAATTAAAAACAACTTTCCTGAAGAATTCGAA AAAAGACAGAAAGATAAGTTGAGATACAGATACCCTGGTATTGGCGGTGAATCGTATATG GACGTTATTAATAGACTCAGACCTGTTATCACAGAACTAGAAAGAATCGAGGATAACGTT CTTATTATTACACACCGGGTGGTGGCAAGAGCCTTATTGGGTTATTTTATGAACTTGAGT ATGGGTATTATTGCCAATTTGGATGTCCCATTACATTGTGTATATTGCCTAGAACCAAAA CCATATGGAATCACTTGGTCATTATGGGAGTATGATGAAGCATCGGATTCATTTTCTAAG GTCCCACAAACGGACTTGAATACCACCAGAGTAAAGGAGGTTGGCCTTGTTTATAATGAA AGAAGATATTCTGTTATACCAACAGCTCCGCCAAGTGCAAGAAGCAGCTTTGCAAGTGAC TTTTTGTCAAGAAAAAGATCTAATCCTACTTCTGCATCTTCATCCCAGAGTGAATTATCA GAACAACCCAAGAATAGCGTTAGTGCTCAAACTGGCAGCAATAATACCACTCTCATTGGG AGCAACTTTAACATCAAGAATGAAAATGGTGATTCGAGAATACCATTATCTGCACCACTT ATGGCCACTAATACTTCTAATAACATCTTAGATGGTGGAGGTACCTCAATTTCGATACAT CGTCCCAGGGTTGTTCCAAATCAAAACAACGTGAATCCCCTTTTGGCTAACAACAATAAA GCGGCTTCTAATGTACCTAATGTAAAGAAGTCAGCGGCTACACCAAGGCAAATTTTTGAA ATAGATAAAGTGGACGAAAAGTTATCCATGTTGAAAAATAAAAGTTTTCTATTACATGGA AAGGATTATCCTAATAATGCTGATAATAATGACAACGAAGATATAAGGGCAAAAACCATG AATCGCAGCCAAAGTCACGTTTAA
Protein Properties
Pfam Domain Function
Protein Residues827
Protein Molecular Weight93416.20313
Protein Theoretical pI9.02
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphofructo-2-kinase 1 MFKPVDFSETSPVPPDIDLAPTQSPHHVAPSQDSSYDLLSRSSDDKIDAEKGPHDELSKH LPLFQKRPLSDTPISSNWNSPGITEENTPSDSPENSATNLKSLHRLHINDETQLKNAKIP TNDTTDYMPPSDGANEVTRIDLKDIKSPTRHHKRRPTTIDVPGLTKSKTSPDGLISKEDS GSKLVIVMVGLPATGKSFITNKLSRFLNYSLYYCKVFNVGNTRRKFAKEHGLKDQDSKFF EPKNADSTRLRDKWAMDTLDELLDYLLEGSGSVGIFDATNTSRERRKNVLARIRKRSPHL KVLFLESVCSDHALVQKNIRLKLFGPDYKGKDPESSLKDFKSRLANYLKAYEPIEDDENL QYIKMIDVGKKVIAYNIQGFLASQTVYYLLNFNLADRQIWITRSGESEDNVSGRIGGNSH LTPRGLRFAKSLPKFIARQREIFYQNLMQQKKNNENTDGNIYNDFFVWTSMRARTIGTAQ YFNEDDYPIKQMKMLDELSAGDYDGMTYPEIKNNFPEEFEKRQKDKLRYRYPGIGGESYM DVINRLRPVITELERIEDNVLIITHRVVARALLGYFMNLSMGIIANLDVPLHCVYCLEPK PYGITWSLWEYDEASDSFSKVPQTDLNTTRVKEVGLVYNERRYSVIPTAPPSARSSFASD FLSRKRSNPTSASSSQSELSEQPKNSVSAQTGSNNTTLIGSNFNIKNENGDSRIPLSAPL MATNTSNNILDGGGTSISIHRPRVVPNQNNVNPLLANNNKAASNVPNVKKSAATPRQIFE IDKVDEKLSMLKNKSFLLHGKDYPNNADNNDNEDIRAKTMNRSQSHV
References
External Links
ResourceLink
Saccharomyces Genome Database PFK26
Uniprot IDP40433
Uniprot Name6P21_YEAST
GenBank Gene IDAY692819
Genebank Protein ID51013089
General Reference
  • Kretschmer, M., Fraenkel, D. G. (1991). "Yeast 6-phosphofructo-2-kinase: sequence and mutant." Biochemistry 30:10663-10672.1657152
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kretschmer, M., Tempst, P., Fraenkel, D. G. (1991). "Identification and cloning of yeast phosphofructokinase 2." Eur J Biochem 197:367-372.1851090
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956