You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAldehyde dehydrogenase 5, mitochondrial
SynonymsNot Available
Gene NameALD5
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionMinor mitochondrial aldehyde dehydrogenase isoform. Plays a role in regulation or biosynthesis of electron transport chain components. Involved in the biosynthesis of acetate during anaerobic growth on glucose
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
NADP + Acetaldehyde + waterAcetic acid + NADPH + hydron
Indoleacetaldehyde + NADP + waterNADPH + hydron + indole-3-acetate
NAD + 4-aminobutanal + waterNADH + gamma-Aminobutyric acid + hydron
Metabolites
YMDB IDNameView
YMDB00022AcetaldehydeShow
YMDB00056Acetic acidShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00335gamma-Aminobutyric acidShow
YMDB00354IndoleacetaldehydeShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00576indole-3-acetateShow
YMDB005874-aminobutanalShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER073W
Gene Sequence>1563 bp ATGCTTTCTCGCACAAGAGCTGCAGCTCCGAATTCCAGAATATTCACTAGAAGCTTGTTA CGTCTTTATTCTCAAGCACCATTACGCGTTCCAATTACTCTTCCAAATGGTTTCACCTAC GAACAGCCAACAGGGTTATTCATCAATGGTGAATTTGTTGCCTCGAAGCAAAAGAAAACG TTTGACGTGATCAATCCATCTAACGAAGAAAAGATAACAACTGTATACAAGGCTATGGAA GATGATGTTGATGAAGCCGTTGCAGCGGCTAAAAAAGCTTTTGAAACGAAGTGGTCTATT GTAGAGCCGGAGGTTCGCGCTAAAGCTTTATTCAATCTCGCTGACTTGGTTGAGAAACAC CAAGAAACACTGGCTGCCATTGAGTCAATGGATAATGGTAAGTCATTGTTTTGTGCGCGC GGTGACGTCGCTTTAGTATCTAAATACTTGCGTTCTTGCGGTGGTTGGGCAGATAAAATC TACGGTAACGTTATTGACACAGGTAAAAACCATTTTACCTACTCAATTAAGGAACCATTA GGCGTTTGCGGCCAAATAATCCCTTGGAACTTCCCTTTATTGATGTGGTCATGGAAAATT GGGCCTGCTCTGGCTACAGGTAACACCGTCGTATTGAAACCCGCTGAAACAACACCTTTA TCTGCCCTTTTCGCTTCCCAGTTGTGTCAGGAAGCAGGCATACCCGCTGGTGTAGTCAAT ATCCTTCCGGGTTCCGGTAGAGTTGTTGGAGAAAGATTGAGTGCACACCCAGACGTGAAG AAGATTGCTTTTACAGGCTCTACTGCCACCGGCCGCCATATTATGAAGGTCGCTGCCGAT ACTGTCAAGAAAGTCACTTTGGAGCTGGGAGGTAAATCACCAAATATTGTGTTTGCTGAC GCTGATCTAGATAAAGCCGTCAAGAACATTGCCTTCGGTATTTTTTACAACTCTGGTGAA GTTTGCTGCGCTGGTTCCAGAATATACATTCAAGATACAGTATACGAGGAGGTGTTGCAA AAACTAAAGGATTACACCGAGTCACTAAAGGTCGGTGACCCATTTGATGAGGAAGTTTTC CAAGGTGCTCAAACATCTGACAAACAGCTGCATAAAATTTTAGACTATGTCGATGTAGCA AAATCAGAGGGGGCTCGTCTTGTGACTGGAGGGGCCAGACATGGCAGTAAAGGTTATTTT GTCAAGCCAACAGTGTTTGCTGATGTCAAAGGAGATATGAGAATTGTTAAGGAGGAAGTG TTTGGTCCCATTGTAACTGTATCCAAGTTTTCTACTGTTGATGAAGTGATTGCTATGGCA AATGATTCTCAATATGGGTTAGCCGCAGGTATTCACACTAACGATATTAACAAGGCTGTT GATGTGTCCAAAAGAGTGAAAGCTGGTACTGTTTGGATAAATACCTATAACAACTTCCAC CAAAATGTTCCTTTCGGTGGCTTCGGCCAGTCAGGTATTGGCCGTGAAATGGGTGAGGCT GCTTTAAGTAACTACACTCAAACAAAATCTGTCAGAATTGCCATTGACAAGCCAATTCGT TGA
Protein Properties
Pfam Domain Function
Protein Residues520
Protein Molecular Weight56620.39844
Protein Theoretical pI8.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aldehyde dehydrogenase 5, mitochondrial MLSRTRAAAPNSRIFTRSLLRLYSQAPLRVPITLPNGFTYEQPTGLFINGEFVASKQKKT FDVINPSNEEKITTVYKAMEDDVDEAVAAAKKAFETKWSIVEPEVRAKALFNLADLVEKH QETLAAIESMDNGKSLFCARGDVALVSKYLRSCGGWADKIYGNVIDTGKNHFTYSIKEPL GVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVN ILPGSGRVVGERLSAHPDVKKIAFTGSTATGRHIMKVAADTVKKVTLELGGKSPNIVFAD ADLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLQKLKDYTESLKVGDPFDEEVF QGAQTSDKQLHKILDYVDVAKSEGARLVTGGARHGSKGYFVKPTVFADVKGDMRIVKEEV FGPIVTVSKFSTVDEVIAMANDSQYGLAAGIHTNDINKAVDVSKRVKAGTVWINTYNNFH QNVPFGGFGQSGIGREMGEAALSNYTQTKSVRIAIDKPIR
References
External Links
ResourceLink
Saccharomyces Genome Database ALD5
Uniprot IDP40047
Uniprot NameALDH5_YEAST
GenBank Gene IDU18814
Genebank Protein ID603310
General Reference
  • Wang, X., Bai, Y., Ni, L., Weiner, H. (1997). "Saccharomyces cerevisiae aldehyde dehydrogenases. Identification and expression." Adv Exp Med Biol 414:277-280.9059631
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Wang, X., Mann, C. J., Bai, Y., Ni, L., Weiner, H. (1998). "Molecular cloning, characterization, and potential roles of cytosolic and mitochondrial aldehyde dehydrogenases in ethanol metabolism in Saccharomyces cerevisiae." J Bacteriol 180:822-830.9473035
  • Kurita, O., Nishida, Y. (1999). "Involvement of mitochondrial aldehyde dehydrogenase ALD5 in maintenance of the mitochondrial electron transport chain in Saccharomyces cerevisiae." FEMS Microbiol Lett 181:281-287.10585550
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Saint-Prix, F., Bonquist, L., Dequin, S. (2004). "Functional analysis of the ALD gene family of Saccharomyces cerevisiae during anaerobic growth on glucose: the NADP+-dependent Ald6p and Ald5p isoforms play a major role in acetate formation." Microbiology 150:2209-2220.15256563