You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable cation-transporting ATPase 1
SynonymsNot Available
Gene NameSPF1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + H(2)O = ADP + phosphate
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
ATPase activity, coupled to transmembrane movement of ions
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
binding
hydrolase activity, acting on acid anhydrides
nucleoside binding
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
catalytic activity
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
transporter activity
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
transmembrane transporter activity
pyrophosphatase activity
nucleoside-triphosphatase activity
ATPase activity
hydrolase activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
cation transport
metabolic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
establishment of localization
nitrogen compound metabolic process
transport
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
ion transport
Gene Properties
Chromosome Locationchromosome 5
LocusYEL031W
Gene Sequence>3648 bp ATGACAAAGAAATCATTTGTGAGCAGTCCTATTGTTAGGGACTCGACATTGCTGGTACCA AAGTCATTAATAGCAAAGCCGTACGTATTACCGTTTTTCCCGTTATACGCTACCTTTGCC CAACTATATTTCCAGCAATATGATCGTTACATCAAAGGACCTGAGTGGACTTTTGTCTAC TTGGGGACATTGGTATCCTTGAACATCCTAGTCATGTTAATGCCTGCTTGGAATGTCAAG ATCAAGGCGAAATTCAACTACAGTACTACTAAAAATGTCAATGAAGCTACTCACATTCTC ATCTACACCACTCCAAATAATGGTTCTGATGGTATCGTTGAAATTCAGAGAGTAACTGAA GCGGGCTCTTTGCAGACTTTTTTCCAATTTCAAAAGAAAAGATTCTTGTGGCATGAAAAT GAGCAGGTATTTTCTTCACCAAAGTTCCTTGTTGATGAATCCCCAAAGATCGGTGATTTC CAAAAATGTAAGGGCCATTCCGGTGACCTAACTCATTTGAAGAGACTATATGGTGAGAAT AGTTTTGATATTCCTATTCCAACATTTATGGAATTATTCAAAGAGCACGCTGTTGCGCCA TTGTTTGTTTTCCAAGTTTTCTGTGTTGCCTTATGGCTATTGGATGAGTTCTGGTATTAT TCTTTGTTTAACTTATTCATGATTATCTCCATGGAGGCAGCTGCAGTATTTCAAAGATTA ACTGCCTTGAAGGAATTTAGAACTATGGGTATCAAACCTTATACCATTAACGTGTTTAGA AACAAAAAATGGGTAGCATTGCAAACCAATGAATTGTTACCTATGGATTTAGTGTCTATA ACAAGAACCGCCGAGGAGAGCGCAATTCCTTGCGATTTGATCTTGCTCGATGGCTCCGCT ATTGTTAATGAAGCAATGCTTTCAGGTGAATCTACTCCCTTGTTAAAGGAATCCATTAAA TTACGTCCTAGTGAAGATAATTTACAACTGGACGGTGTTGACAAGATTGCTGTGTTACAT GGTGGTACAAAGGCATTACAAGTAACACCTCCTGAACATAAATCGGATATCCCTCCTCCA CCTGATGGAGGTGCCTTAGCCATCGTCACCAAAACTGGCTTTGAAACATCTCAGGGTTCT TTAGTTCGAGTTATGATTTACTCCGCTGAACGTGTTTCCGTCGATAATAAGGAAGCGTTG ATGTTCATTCTTTTCTTGTTGATTTTCGCTGTTATTGCATCCTGGTACGTTTGGGTTGAG GGTACAAAAATGGGTAGAATTCAATCCAAATTGATCTTGGACTGTATATTAATTATTACA TCTGTTGTTCCTCCTGAGTTACCAATGGAATTGACCATGGCTGTCAACAGTTCTCTGGCC GCCCTTGCCAAGTTCTATGTCTATTGTACTGAACCATTTAGAATTCCATTTGCTGGTAGA ATTGATGTTTGTTGTTTCGATAAAACTGGTACTTTGACCGGCGAAGATCTTGTGTTTGAA GGTCTAGCTGGTATCTCTGCGGACTCCGAAAACATTCGTCACTTGTACAGCGCTGCCGAA GCACCAGAAAGTACAATTCTTGTCATTGGTGCTGCTCACGCTTTAGTTAAATTGGAAGAT GGTGATATTGTTGGTGACCCAATGGAAAAGGCGACCTTAAAGGCTGTTGGTTGGGCTGTC GAAAGAAAAAACAGTAACTATAGAGAGGGCACCGGAAAATTGGATATTATCCGTAGATTT CAATTTTCTTCTGCTTTAAAAAGGTCTGCTTCTATTGCTTCTCACAACGATGCCTTGTTT GCTGCTGTCAAAGGTGCACCTGAAACGATTCGTGAAAGGCTTTCTGACATTCCCAAGAAT TATGACGAAATCTATAAATCCTTTACACGCTCTGGTTCAAGAGTTTTGGCTTTGGCTTCT AAGTCGTTGCCAAAAATGTCTCAGTCTAAAATTGATGATCTAAACCGTGATGATGTTGAA TCTGAATTAACCTTTAATGGGTTTTTGATTTTCCATTGTCCTCTGAAGGATGACGCTATT GAAACCATTAAAATGTTAAATGAATCCTCCCATCGTTCTATTATGATTACTGGTGATAAT CCATTAACTGCTGTTCATGTGGCTAAAGAAGTTGGCATAGTTTTTGGCGAAACTTTAATC TTAGACAGAGCAGGTAAATCTGACGACAATCAGTTGCTGTTCCGTGATGTTGAAGAGACA GTTTCCATCCCATTTGATCCATCAAAAGACACTTTTGATCATTCTAAATTATTTGATAGA TATGATATTGCTGTTACTGGATATGCTTTGAATGCCTTGGAAGGGCATTCTCAATTAAGG GATCTATTACGTCACACCTGGGTTTACGCACGTGTTTCACCATCCCAAAAGGAGTTCTTG CTGAATACACTAAAGGATATGGGATATCAAACTTTAATGTGCGGTGATGGTACTAATGAT GTTGGTGCTTTGAAACAAGCTCATGTTGGTATTGCATTGTTGAATGGTACCGAAGAAGGT TTGAAAAAATTGGGTGAACAACGCAGATTGGAAGGTATGAAAATGATGTATATAAAGCAA ACTGAATTTATGGCTAGATGGAATCAACCACAGCCACCTGTTCCTGAACCGATTGCACAC TTATTCCCACCTGGTCCAAAAAATCCTCATTATCTGAAAGCTTTAGAAAGCAAAGGTACC GTCATTACGCCAGAAATCAGAAAAGCAGTTGAAGAAGCAAATTCCAAACCTGTTGAAGTC ATCAAACCAAATGGACTATCGGAAAAAAAACCTGCTGACTTAGCTTCTTTGTTGTTGAAC TCTGCTGGTGATGCCCAAGGTGATGAAGCACCAGCTCTAAAGTTAGGAGATGCATCTTGC GCTGCCCCTTTTACCTCGAAACTGGCCAATGTTTCTGCTGTTACTAACATTATACGTCAA GGCCGTTGTGCTTTAGTTAACACAATTCAAATGTACAAAATCTTGGCCTTGAATTGTTTA ATCAGTGCCTACTCTTTGTCCATCATTTACATGGCTGGTGTCAAATTTGGTGATGGTCAA GCCACTGTCTCCGGTTTGTTACTATCGGTTTGTTTCTTGAGTATTTCCCGTGGTAAACCT TTAGAAAAACTATCCAAGCAAAGGCCACAGTCCGGAATTTTCAATGTTTACATTATGGGA TCTATTTTGTCTCAATTTGCCGTTCATATTGCCACTTTAGTTTACATCACTACAGAGATT TATAAATTGGAACCCAGAGAGCCACAAGTTGATCTTGAAAAGGAATTTGCTCCATCATTA TTGAATACGGGTATTTTCATCATTCAGTTGGTACAACAAGTCTCTACATTTGCTGTCAAT TATCAAGGTGAGCCATTCAGAGAAAACATTAGGAGTAACAAAGGTATGTATTATGGTTTA TTGGGTGTGACAGGTTTGGCACTTGCAAGTGCTACTGAATTTTTACCTGAGCTAAACGAA GCCATGAAGTTTGTGCCAATGACTGATGACTTTAAGATTAAGTTGACCCTAACATTATTG CTCGATTTCTTTGGTAGTTGGGGTGTCGAGCATTTTTTCAAGTTTTTCTTCATGGACGAC AAACCATCAGACATTTCTGTGCAACAGGTCAAGATTGCCTCTAAATGA
Protein Properties
Pfam Domain Function
Protein Residues1215
Protein Molecular Weight135267.0
Protein Theoretical pI6.56
Signalling Regions
  • None
Transmembrane Regions
  • 22-43
  • 50-72
  • 192-214
  • 218-236
  • 400-419
  • 433-454
  • 994-1013
  • 1021-1037
  • 1056-1079
  • 1100-1122
  • 1134-1153
  • 1171-1193
Protein Sequence>Probable cation-transporting ATPase 1 MTKKSFVSSPIVRDSTLLVPKSLIAKPYVLPFFPLYATFAQLYFQQYDRYIKGPEWTFVY LGTLVSLNILVMLMPAWNVKIKAKFNYSTTKNVNEATHILIYTTPNNGSDGIVEIQRVTE AGSLQTFFQFQKKRFLWHENEQVFSSPKFLVDESPKIGDFQKCKGHSGDLTHLKRLYGEN SFDIPIPTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYSLFNLFMIISMEAAAVFQRL TALKEFRTMGIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDGSA IVNEAMLSGESTPLLKESIKLRPSEDNLQLDGVDKIAVLHGGTKALQVTPPEHKSDIPPP PDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFAVIASWYVWVE GTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCTEPFRIPFAGR IDVCCFDKTGTLTGEDLVFEGLAGISADSENIRHLYSAAEAPESTILVIGAAHALVKLED GDIVGDPMEKATLKAVGWAVERKNSNYREGTGKLDIIRRFQFSSALKRSASIASHNDALF AAVKGAPETIRERLSDIPKNYDEIYKSFTRSGSRVLALASKSLPKMSQSKIDDLNRDDVE SELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLI LDRAGKSDDNQLLFRDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNALEGHSQLR DLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIALLNGTEEG LKKLGEQRRLEGMKMMYIKQTEFMARWNQPQPPVPEPIAHLFPPGPKNPHYLKALESKGT VITPEIRKAVEEANSKPVEVIKPNGLSEKKPADLASLLLNSAGDAQGDEAPALKLGDASC AAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYMAGVKFGDGQ ATVSGLLLSVCFLSISRGKPLEKLSKQRPQSGIFNVYIMGSILSQFAVHIATLVYITTEI YKLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENIRSNKGMYYGL LGVTGLALASATEFLPELNEAMKFVPMTDDFKIKLTLTLLLDFFGSWGVEHFFKFFFMDD KPSDISVQQVKIASK
References
External Links
ResourceLink
Saccharomyces Genome Database SPF1
Uniprot IDP39986
Uniprot NameATC6_YEAST
GenBank Gene IDU18530
Genebank Protein ID602398
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Suzuki, C., Shimma, Y. I. (1999). "P-type ATPase spf1 mutants show a novel resistance mechanism for the killer toxin SMKT." Mol Microbiol 32:813-823.10361284
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956