You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDiacetyl reductase [(R)-acetoin forming]
SynonymsNot Available
Gene NameBDH1
Enzyme Class
Biological Properties
General FunctionInvolved in zinc ion binding
Specific FunctionCatalyzes the irreversible reduction of 2,3-butanediol to (S)-acetoin in the presence of NADH
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Butanoate metabolismec00650 Map00650
SMPDB ReactionsNot Available
KEGG Reactions
NAD + (R,R)-butane-2,3-diolNADH + hydron + (R)-Acetoin
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00344AcetoinShow
YMDB00367DiacetylShow
YMDB00410(R)-AcetoinShow
YMDB00412NAD(+)Show
YMDB00413(R,R)-butane-2,3-diolShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
oxidoreductase activity
zinc ion binding
catalytic activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 1
LocusYAL060W
Gene Sequence>1149 bp ATGAGAGCTTTGGCATATTTCAAGAAGGGTGATATTCACTTCACTAATGATATCCCTAGG CCAGAAATCCAAACCGACGATGAGGTTATTATCGACGTCTCTTGGTGTGGGATTTGTGGC TCGGATCTTCACGAGTACTTGGATGGTCCAATCTTCATGCCTAAAGATGGAGAGTGCCAT AAATTATCCAACGCTGCTTTACCTCTGGCAATGGGCCATGAGATGTCAGGAATTGTTTCC AAGGTTGGTCCTAAAGTGACAAAGGTGAAGGTTGGCGACCACGTGGTCGTTGATGCTGCC AGCAGTTGTGCGGACCTGCATTGCTGGCCACACTCCAAATTTTACAATTCCAAACCATGT GATGCTTGTCAGAGGGGCAGTGAAAATCTATGTACCCACGCCGGTTTTGTAGGACTAGGT GTGATCAGTGGTGGCTTTGCTGAACAAGTCGTAGTCTCTCAACATCACATTATCCCGGTT CCAAAGGAAATTCCTCTAGATGTGGCTGCTTTAGTTGAGCCTCTTTCTGTCACCTGGCAT GCTGTTAAGATTTCTGGTTTCAAAAAAGGCAGTTCAGCCTTGGTTCTTGGTGCAGGTCCC ATTGGGTTGTGTACCATTTTGGTACTTAAGGGAATGGGGGCTAGTAAAATTGTAGTGTCT GAAATTGCAGAGAGAAGAATAGAAATGGCCAAGAAACTGGGCGTTGAGGTGTTCAATCCC TCCAAGCACGGTCATAAATCTATAGAGATACTACGTGGTTTGACCAAGAGCCATGATGGG TTTGATTACAGTTATGATTGTTCTGGTATTCAAGTTACTTTCGAAACCTCTTTGAAGGCA TTAACATTCAAGGGGACAGCCACCAACATTGCAGTTTGGGGTCCAAAACCTGTCCCATTC CAACCAATGGATGTGACTCTCCAAGAGAAAGTTATGACTGGTTCGATCGGCTATGTTGTC GAAGCCTTCGAAGAAGTTGTTCGTGCCATCCACAACGGAGACATCGCCATGGAAGATTGT AAGCAACTAATCACTGGTAAGCAAAGGATTGAGGACGGTTGGGAAAAGGGATTCCAAGAG TTGATGGATCACAAGGAATCCAACGTTAAGATTCTATTGACGCCTAACAATCACGGTGAA ATGAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues382
Protein Molecular Weight41537.69922
Protein Theoretical pI6.65
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Diacetyl reductase [(R)-acetoin forming] MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGPIFMPKDGECH KLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPC DACQRGSENLCTHAGFVGLGVISGGFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNP SKHGHKSIEILRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF QPMDVTLQEKVMTGSIGYVVEAFEEVVRAIHNGDIAMEDCKQLITGKQRIEDGWEKGFQE LMDHKESNVKILLTPNNHGEMK
References
External Links
ResourceLink
Saccharomyces Genome Database BDH1
Uniprot IDP39714
Uniprot NameBDH1_YEAST
GenBank Gene IDU12980
Genebank Protein ID595526
General Reference
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Gonzalez, E., Fernandez, M. R., Larroy, C., Sola, L., Pericas, M. A., Pares, X., Biosca, J. A. (2000). "Characterization of a (2R,3R)-2,3-butanediol dehydrogenase as the Saccharomyces cerevisiae YAL060W gene product. Disruption and induction of the gene." J Biol Chem 275:35876-35885.10938079
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106