You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSulfite reductase [NADPH] flavoprotein component
SynonymsNot Available
Gene NameMET10
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionThis enzyme catalyzes the 6-electron reduction of sulfite to sulfide. This is one of several activities required for the biosynthesis of L-cysteine from sulfate
Cellular LocationNot Available
SMPDB Pathways
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Sulfur metabolismec00920 Map00920
SMPDB ReactionsNot Available
KEGG Reactions
NADP + water + Hydrogen sulfidehydron + Sulfite + NADPH
Metabolites
YMDB IDNameView
YMDB00114SulfiteShow
YMDB00121SulfideShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00653Hydrogen sulfideShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFR030W
Gene Sequence>3108 bp ATGCCAGTTGAGTTTGCTACCAATCCTTTTGGCGAGGCCAAAAATGCAACTTCACTGCCA AAATATGGTACACCCGTAACTGCCATTTCATCTGTGCTGTTCAATAACGTGGACTCCATT TTTGCTTACAAGTCCTTTTCTCAACCCGATTTGCTACACCAAGATCTAAAAAAATGGTCT GAAAAGCGTGGTAACGAATCACGTGGGAAGCCATTTTTCCAAGAGCTGGATATCAGATCT GGCGCTGGTTTGGCTCCTTTAGGGTTTTCTCATGGATTGAAGAACACTACAGCAATTGTT GCTCCAGGGTTTTCGCTGCCATACTTCATTAACTCTTTGAAAACCGTCTCTCATGATGGT AAGTTTCTTTTGAATGTTGGTGCTTTAAACTACGACAATGCTACCGGCTCTGTCACCAAC GATTATGTAACCGCATTGGATGCTGCTTCCAAGCTGAAGTATGGTGTCGTGACTCCGATT TCCGCTAACGAGGTACAAAGTGTCGCCTTACTGACATTGGCGATTGCCACTTTCAGTAAT AACTCCGGAGCTATCAATTTATTTGACGGATTAAACTACTCGAAAACCGTCTTGCCGTTG GTCGAATCTGTTCCTGAGGCATCTATTTTGGCAAAACTATCCAAAGTTATTGCACCAGAT GCTGCCTTTGATGATGTCTTGGATAAGTTTAATGAATTGACTGGATTGAGACTACATAAT TTCCAATACTTTGGTGCTCAGGATGCTGAAACTGTGTTTATCACTTATGGGTCTTTAGAA TCCGAATTGTTCAACTCTGCGATTAGTGGTAATAATTCCAAAATCGGGTTAATCAACGTC AGAGTACCATTACCTTTTAACGTTGCTAAGTTTGTCACTCACGTTCCATCCACTACCAAA CAAATTGTTGTTATAGGCCAAACTTTGGATGGTTCTTCGCCTTCTTTCTTGAGATCTCAA GTTTCAGCCGCCTTATTTTACCACGGCCGCACCTCAATTAGCGTTTCTGAGTACATCTAT CAACCAGATTTCATTTGGTCCCCAAAAGCTGTCAAATCAATTGTATCGTCATTCATCCCT GAATTCACTTACAATGCCGATTCATCTTTCGGCGAAGGATTCATTTATTGGGCCTCTGAT AAGAGTATCAATATTGATGTTGCCTCCAAACTTGTGAAAGCTCTGTCTTTGGAAGATGGG AAATTTGTGTCTTTGAGAACGAAATTTGATAACTTGGCTAATGCTGGTACCTTCCAAGCT CAATTTGTGACCTCGAAAGAACAGATACCTGTTTCAAACATCGATTCTACGAAATTATCA GTCGTTGAAGATGTCAGTTTATTGAAGCATTTAGACGTAGCTGCTACCGTCGCAGAACAA GGTTCAATTGCGTTGGTTTCCCAAAAGGCAGTTAAAGATTTGGATTTAAATTCTGTAGAA AGTTACGTCAAGAATTTGGGAATTCCTGAATCATTCCTAATATCTATTGCGAAGAAAAAC ATCAAATTGTTTATCATCGATGGTGAGACCACTAACGACGAGTCCAAATTGTCCTTGTTT ATCCAAGCCGTTTTCTGGAAATTGGCCTTCGGTCTAGATGTCGCAGAATGTACCAACCGT ATCTGGAAAAGCATTGATTCAGGTGCAGACATTTCAGCAGCCTCGATTTCTGAATTTCTC ACTGGTGCATTCAAAAACTTCCTCAGTGAGGTTCCGCTAGCGCTGTACACTAAATTTTCT GAAATAAACATTGAAAAGAAAGAGGATGAGGAAGAGCCTGCAGCTTTACCAATTTTCGTT AATGAAACATCTTTCCTCCCAAATAACAGTACCATTGAAGAAATACCATTACCTGAGACC TCTGAGATCTCTGATATTGCCAAGAAGTTGTCCTTCAAAGAGGCATATGAAGTTGAGAAT AAACTAAGACCCGATTTACCCGTCAAGAACTTCGTCGTGAAAGTTAAAGAAAATAGACGT GTTACGCCTGCTGATTATGATAGATATATTTTCCATATTGAATTCGATATTTCTGGTACT GGAATGACTTATGACATCGGTGAAGCCCTCGGTATTCATGCCAGAAACAATGAATCTTTG GTCAAAGAATTCTTAACCTTCTATGGTCTAAATGAATCCGATGTTGTCTTAGTCCCCAAC AAGGACAACCACCATTTGTTAGAAACAAGAACCGTCTTACAAGCATTTGTGGAAAATTTG GATATTTTCGGTAAACCACCAAAAAGATTTTACGAATCATTGATTCCATATGCCTCTAAC GAAGAGGAGAAGAAAAAATTAGAGGATTTGGTTACTCCTGCCGGTGCAGTAGATTTGAAG AGATTTCAAGATGTGGAGTATTATACATATGCTGACATTTTTGAATTGTTCCCATCTGTT CGCCCATCTCTTGAGGAACTTGTTACTATCATTGAACCATTGAAGAGAAGAGAATACTCA ATTGCCTCCTCTCAGAAAGTTCATCCAAATGAAGTTCATTTATTGATCGTTGTTGTTGAT TGGGTGGATAATAAAGGAAGAAAAAGGTACGGTCAAGCTTCTAAGTATATCTCAGACCTT GCTGTCGGTTCAGAATTGGTCGTTAGCGTTAAACCATCTGTTATGAAATTACCACCATCT CCAAAGCAACCAGTTATTATGAGTGGTTTAGGTACTGGTTTGGCACCATTCAAGGCCATT GTTGAAGAGAAATTATGGCAAAAGCAGCAAGGTTATGAGATTGGTGAAGTCTTCCTATAT CTAGGTTCAAGACACAAAAGAGAAGAATATTTATATGGTGAGTTATGGGAGGCTTACAAA GATGCAGGTATTATCACACACATCGGCGCTGCTTTCTCAAGAGACCAACCTCAAAAAATT TACATTCAAGATCGTATCAAAGAGAATTTGGATGAATTAAAAACTGCAATGATTGATAAT AAAGGTTCATTTTACTTGTGTGGCCCTACTTGGCCAGTTCCAGATATTACTCAAGCTTTG CAAGACATTCTGGCTAAAGACGCCGAGGAAAGAGGCATCAAAGTCGACTTGGATGCCGCA ATTGAAGAATTAAAGGAAGCATCAAGATACATTTTAGAAGTCTACTAA
Protein Properties
Pfam Domain Function
Protein Residues1035
Protein Molecular Weight114827.0
Protein Theoretical pI4.91
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Sulfite reductase [NADPH] flavoprotein component MPVEFATNPFGEAKNATSLPKYGTPVTAISSVLFNNVDSIFAYKSFSQPDLLHQDLKKWS EKRGNESRGKPFFQELDIRSGAGLAPLGFSHGLKNTTAIVAPGFSLPYFINSLKTVSHDG KFLLNVGALNYDNATGSVTNDYVTALDAASKLKYGVVTPISANEVQSVALLALAIATFSN NSGAINLFDGLNYSKTVLPLVESVPEASILAKLSKVIAPDAAFDDVLDKFNELTGLRLHN FQYFGAQDAETVFITYGSLESELFNSAISGNNSKIGLINVRVPLPFNVAKFVTHVPSTTK QIVVIGQTLDGSSPSFLRSQVSAALFYHGRTSISVSEYIYQPDFIWSPKAVKSIVSSFIP EFTYNADSSFGEGFIYWASDKSINIDVASKLVKALSLEDGKFVSLRTKFDNLANAGTFQA QFVTSKEQIPVSNIDSTKLSVVEDVSLLKHLDVAATVAEQGSIALVSQKAVKDLDLNSVE SYVKNLGIPESFLISIAKKNIKLFIIDGETTNDESKLSLFIQAVFWKLAFGLDVAECTNR IWKSIDSGADISAASISEFLTGAFKNFLSEVPLALYTKFSEINIEKKEDEEEPAALPIFV NETSFLPNNSTIEEIPLPETSEISDIAKKLSFKEAYEVENKLRPDLPVKNFVVKVKENRR VTPADYDRYIFHIEFDISGTGMTYDIGEALGIHARNNESLVKEFLTFYGLNESDVVLVPN KDNHHLLETRTVLQAFVENLDIFGKPPKRFYESLIPYASNEEEKKKLEDLVTPAGAVDLK RFQDVEYYTYADIFELFPSVRPSLEELVTIIEPLKRREYSIASSQKVHPNEVHLLIVVVD WVDNKGRKRYGQASKYISDLAVGSELVVSVKPSVMKLPPSPKQPVIMSGLGTGLAPFKAI VEEKLWQKQQGYEIGEVFLYLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPQKI YIQDRIKENLDELKTAMIDNKGSFYLCGPTWPVPDITQALQDILAKDAEERGIKVDLDAA IEELKEASRYILEVY
References
External Links
ResourceLink
Saccharomyces Genome Database MET10
Uniprot IDP39692
Uniprot NameMET10_YEAST
GenBank Gene IDD44610
Genebank Protein ID624931
General Reference
  • Hansen, J., Cherest, H., Kielland-Brandt, M. C. (1994). "Two divergent MET10 genes, one from Saccharomyces cerevisiae and one from Saccharomyces carlsbergensis, encode the alpha subunit of sulfite reductase and specify potential binding sites for FAD and NADPH." J Bacteriol 176:6050-6058.7928966
  • Hosseini-Mazinani, S. M., Koshikawa, N., Sugimoto, K., Aoki, Y., Arisawa, M. (1995). "Cloning and sequencing of sulfite reductase alpha subunit gene from Saccharomyces cerevisiae." DNA Res 2:15-19.7788524
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Eki, T., Naitou, M., Hagiwara, H., Abe, M., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Shibata, T., Watanabe, K., et, a. l. .. (1996). "Fifteen open reading frames in a 30.8 kb region of the right arm of chromosome VI from Saccharomyces cerevisiae." Yeast 12:177-190.8686381
  • Strunnikov, A. V., Hogan, E., Koshland, D. (1995). "SMC2, a Saccharomyces cerevisiae gene essential for chromosome segregation and condensation, defines a subgroup within the SMC family." Genes Dev 9:587-599.7698648
  • Kobayashi, K., Yoshimoto, A. (1982). "Studies on yeast sulfite reductase. IV. Structure and steady-state kinetics." Biochim Biophys Acta 705:348-356.6751400
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106