You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative inosine-5'-monophosphate dehydrogenase IMD1
Synonyms
  • IMP dehydrogenase
  • IMPD
  • IMPDH
Gene NameIMD1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionInosine 5'-phosphate + NAD(+) + H(2)O = xanthosine 5'-phosphate + NADH
Cellular LocationNot Available
SMPDB Pathways
purine nucleotides de novo biosynthesisPW002478 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB Reactions
Inosinic acid + NAD + waterNADH + hydron + Xanthylic acid
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00289Xanthylic acidShow
YMDB00352Inosinic acidShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 1
LocusYAR073W
Gene Sequence>1212 bp ATGGCCGCCATTAGAGACTACAAGACCGCACTAGATCTTACCAAGAGCCTACCAAGACCG GATGGTTTGTCAGTGCAGGAACTGATGGACTCCAAGATCAGAGGTGGGTTGGCTTATAAC GATTTTTTAATCTTACCAGGTTTAGTCGATTTTGCGTCCTCTGAAGTTAGCCTACAGACC AAGCTAACCAGGAATATTACTTTAAACATTCCATTAGTATCCTCTCCAATGGACACTGTG ACGGAATCTGAAATGGCCACTTTTATGGCTCTGTTGGATGGTATCGGTTTCATTCACCAT AACTGTACTCCAGAGGACCAAGCTGACATGGTCAGAAGAGTCAAGAACTATGAAAATGGG TTTATTAACAACCCTATAGTGATTTCTCCAACTACGACCGTTGGTGAAGCTAAGAGCATG AAGGAAAAGTATGGATTTGCAGGCTTCCCTGTCACGGCAGATGGAAAGAGAAATGCAAAG TTGGTGGGTGCCATCACCTCTCGTGATATACAATTCGTTGAGGACAACTCTTTACTCGTT CAGGATGTCATGACCAAAAACCCTGTTACCGGCGCACAAGGTATCACATTATCAGAAGGT AACGAAATTCTAAAGAAAATCAAAAAGGGTAGGCTACTGGTTGTTGATGAAAAGGGTAAC TTAGTTTCTATGCTTTCCCGAACTGATTTAATGAAAAATCAGAAGTACCCATTAGCGTCC AAATCTGCCAACACCAAGCAACTGTTATGGGGTGCTTCTATTGGGACTATGGACGCTGAT AAAGAAAGACTAAGATTATTGGTAAAAGCTGGCTTGGATGTCGTCATATTGGATTCCTCT CAAGGTAACTCTATTTTCCAATTGAACATGATCAAATGGATTAAAGAAACTTTCCCAGAT TTGGAAATCATTGCTGGTAACGTTGTCACCAAGGAACAAGCTGCCAATTTGATTGCTGCC GGTGCGGACGGTTTGAGAATTGGTATGGGAACTGGCTCTATTTGTATTACCCAAAAAGTT ATGGCTTGTGGTAGGCCACAAGGTACAGCCGTCTACAACGTGTGTGAATTTGCTAACCAA TTCGGTGTTCCATGTATGGCTGATGGTGGTGTTCAAAAACATTGGTCATATTATTACCAA AGCTTTGGCTCTTGGTTCTTCTACTGTTATGATGGGTGGTATGTTGGCCGGTACTACCGA ATCACCAGGTGA
Protein Properties
Pfam Domain Function
Protein Residues403
Protein Molecular Weight44385.80078
Protein Theoretical pI8.32
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative inosine-5'-monophosphate dehydrogenase IMD1 MAAIRDYKTALDLTKSLPRPDGLSVQELMDSKIRGGLAYNDFLILPGLVDFASSEVSLQT KLTRNITLNIPLVSSPMDTVTESEMATFMALLDGIGFIHHNCTPEDQADMVRRVKNYENG FINNPIVISPTTTVGEAKSMKEKYGFAGFPVTADGKRNAKLVGAITSRDIQFVEDNSLLV QDVMTKNPVTGAQGITLSEGNEILKKIKKGRLLVVDEKGNLVSMLSRTDLMKNQKYPLAS KSANTKQLLWGASIGTMDADKERLRLLVKAGLDVVILDSSQGNSIFQLNMIKWIKETFPD LEIIAGNVVTKEQAANLIAAGADGLRIGMGTGSICITQKVMACGRPQGTAVYNVCEFANQ FGVPCMADGGVQKHWSYYYQSFGSWFFYCYDGWYVGRYYRITR
References
External Links
ResourceLink
Saccharomyces Genome Database IMD1
Uniprot IDP39567
Uniprot NameIMDH1_YEAST
GenBank Gene IDL28920
Genebank Protein ID456156
General Reference
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Hyle, J. W., Shaw, R. J., Reines, D. (2003). "Functional distinctions between IMP dehydrogenase genes in providing mycophenolate resistance and guanine prototrophy to yeast." J Biol Chem 278:28470-28478.12746440
  • Barton, A. B., Kaback, D. B. (2006). "Telomeric silencing of an open reading frame in Saccharomyces cerevisiae." Genetics 173:1169-1173.16582424
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956