You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable aconitate hydratase 2
Synonyms
  • Aconitase
  • Citrate hydro-lyase
Gene NameACO2
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionCitrate = isocitrate
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glyoxylate and dicarboxylate metabolismec00630 Map00630
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00026Isocitric acidShow
YMDB00086Citric acidShow
GO Classification
Component
Not Available
Function
carbon-oxygen lyase activity
hydro-lyase activity
4 iron, 4 sulfur cluster binding
aconitate hydratase activity
catalytic activity
lyase activity
binding
metal cluster binding
iron-sulfur cluster binding
Process
coenzyme metabolic process
acetyl-CoA metabolic process
acetyl-CoA catabolic process
tricarboxylic acid cycle
metabolic process
cellular metabolic process
cofactor metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL200C
Gene Sequence>2370 bp ATGCTATCTTCAGCTAATAGGTTTTATATAAAGAGGCATTTGGCAACACATGCCAATATG TTCCCCTCTGTATCTAAAAATTTTCAAACAAAAGTGCCACCTTATGCAAAACTTTTGACC AACCTAGACAAGATTAAACAAATAACAAACAATGCTCCATTGACACTAGCAGAAAAAATT TTATACTCGCATCTTTGCGATCCTGAAGAATCGATTACTTCTTCTGATCTGTCCACCATC CGTGGTAATAAATACTTGAAGCTAAACCCAGACCGTGTAGCTATGCAGGACGCTTCTGCC CAAATGGCGCTTCTACAATTCATGACCACCGGTCTAAATCAAACATCTGTCCCAGCATCC ATACATTGTGATCATTTAATTGTAGGTAAGGACGGTGAAACTAAAGATTTACCCTCTTCC ATAGCTACCAACCAAGAAGTTTTCGATTTCTTGGAGAGTTGCGCAAAGAGATATGGAATT CAATTCTGGGGCCCAGGTTCTGGTATCATTCACCAGATTGTTTTGGAAAATTTCTCAGCT CCAGGTCTAATGATGCTAGGTACTGATTCCCATACACCAAATGCAGGCGGTCTGGGAGCT ATTGCCATCGGGGTTGGTGGTGCGGATGCAGTTGATGCCCTCACAGGCACTCCATGGGAA TTAAAAGCACCAAAAATTTTAGGTGTTAAATTGACCGGAAAGTTAAACGGATGGTCCACT CCTAAAGATGTAATCACAAAGCTCGCTGGTTTACTAACTGTCAGAGGTGGTACTGGTTAT ATCGTCGAGTACTTCGGCGAAGGTGTATCCACTCTATCTTGCACAGGTATGGCAACCATC TGTAATATGGGAGCTGAAATCGGTGCTACAACGTCAACTTTCCCTTACCAAGAAGCTCAC AAGCGTTATTTGCAAGCAACTAATAGAGCAGAGGTCGCTGAAGCAGCTGATGTTGCTTTA AACAAGTTTAACTTCTTAAGAGCCGACAAAGATGCTCAATACGATAAAGTTATTGAAATT GACTTATCCGCAATTGAACCTCACGTTAATGGTCCATTTACACCAGACCTTTCAACCCCA ATATCTCAATATGCCGAAAAAAGTTTGAAGGAAAACTGGCCCCAAAAAGTTAGCGCTGGT TTGATTGGATCATGTACCAATTCATCTTATCAAGACATGAGTCGTGTTGTCGACTTGGTC AAGCAAGCTTCCAAAGCCGGCTTGAAACCACGTATCCCCTTCTTTGTCACCCCTGGTTCA GAACAAATTAGAGCTACCTTGGAAAGAGATGGAATCATCGATATTTTCCAAGAAAATGGT GCCAAAGTTTTAGCAAATGCATGCGGCCCTTGTATCGGACAATGGAATAGGGAAGATGTC TCGAAAACATCAAAAGAAACGAACACTATTTTTACATCATTCAATAGAAATTTCAGAGCT AGAAACGATGGTAATAGGAATACAATGAATTTCTTAACATCCCCAGAAATAGTAACAGCG ATGAGTTATTCTGGAGATGCTCAGTTCAATCCGCTAACTGACTCAATTAAATTGCCAAAT GGGAAGGATTTCAAATTCCAACCACCAAAGGGTGATGAGTTACCAAAAAGAGGATTTGAA CACGGTAGAGACAAATTTTATCCTGAAATGGATCCAAAGCCAGATAGCAATGTAGAGATT AAGGTAGACCCTAATTCTGATCGTTTGCAATTATTAGAGCCATTCAAACCTTGGAACGGG AAGGAATTGAAGACAAACGTGCTTTTGAAAGTTGAAGGTAAATGTACAACAGATCATATT TCCGCTGCGGGCGTCTGGTTGAAATATAAAGGCCATCTAGAAAACATTTCTTACAATACA TTGATTGGTGCACAAAACAAAGAAACCGGTGAAGTCAACAAGGCTTATGACCTTGACGGA ACTGAATATGATATTCCTGGTTTGATGATGAAATGGAAATCAGACGGTAGACCATGGACC GTGATAGCGGAACATAACTATGGTGAAGGTTCCGCAAGAGAGCATGCTGCTTTGTCACCA AGATTTTTAGGCGGAGAGATTCTTTTAGTTAAGTCTTTTGCAAGAATTCATGAGACAAAC TTGAAGAAACAAGGTGTGTTGCCATTGACTTTTGCCAACGAATCTGACTATGATAAAATA TCAAGCGGAGATGTTTTAGAAACGTTGAACCTAGTTGACATGATTGCTAAGGATGGTAAT AACGGTGGTGAAATTGATGTTAAAATTACTAAACCAAACGGTGAATCGTTCACCATCAAG GCAAAACATACTATGTCTAAAGATCAAATCGATTTTTTCAAAGCTGGTTCAGCAATCAAT TATATTGGTAATATACGAAGAAACGAATAA
Protein Properties
Pfam Domain Function
Protein Residues789
Protein Molecular Weight86582.5
Protein Theoretical pI6.95
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable aconitate hydratase 2 MLSSANRFYIKRHLATHANMFPSVSKNFQTKVPPYAKLLTNLDKIKQITNNAPLTLAEKI LYSHLCDPEESITSSDLSTIRGNKYLKLNPDRVAMQDASAQMALLQFMTTGLNQTSVPAS IHCDHLIVGKDGETKDLPSSIATNQEVFDFLESCAKRYGIQFWGPGSGIIHQIVLENFSA PGLMMLGTDSHTPNAGGLGAIAIGVGGADAVDALTGTPWELKAPKILGVKLTGKLNGWST PKDVITKLAGLLTVRGGTGYIVEYFGEGVSTLSCTGMATICNMGAEIGATTSTFPYQEAH KRYLQATNRAEVAEAADVALNKFNFLRADKDAQYDKVIEIDLSAIEPHVNGPFTPDLSTP ISQYAEKSLKENWPQKVSAGLIGSCTNSSYQDMSRVVDLVKQASKAGLKPRIPFFVTPGS EQIRATLERDGIIDIFQENGAKVLANACGPCIGQWNREDVSKTSKETNTIFTSFNRNFRA RNDGNRNTMNFLTSPEIVTAMSYSGDAQFNPLTDSIKLPNGKDFKFQPPKGDELPKRGFE HGRDKFYPEMDPKPDSNVEIKVDPNSDRLQLLEPFKPWNGKELKTNVLLKVEGKCTTDHI SAAGVWLKYKGHLENISYNTLIGAQNKETGEVNKAYDLDGTEYDIPGLMMKWKSDGRPWT VIAEHNYGEGSAREHAALSPRFLGGEILLVKSFARIHETNLKKQGVLPLTFANESDYDKI SSGDVLETLNLVDMIAKDGNNGGEIDVKITKPNGESFTIKAKHTMSKDQIDFFKAGSAIN YIGNIRRNE
References
External Links
ResourceLink
Saccharomyces Genome Database ACO2
Uniprot IDP39533
Uniprot NameACON2_YEAST
GenBank Gene IDX77688
Genebank Protein ID547592
General Reference
  • Purnelle, B., Coster, F., Goffeau, A. (1994). "The sequence of a 36 kb segment on the left arm of yeast chromosome X identifies 24 open reading frames including NUC1, PRP21 (SPP91), CDC6, CRY2, the gene for S24, a homologue to the aconitase gene ACO1 and two homologues to chromosome III genes." Yeast 10:1235-1249.7754713
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106