You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDihydroxy-acid dehydratase, mitochondrial
Synonyms
  • DAD
  • 2,3-dihydroxy acid hydrolyase
Gene NameILV3
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific Function2,3-dihydroxy-3-methylbutanoate = 3-methyl-2- oxobutanoate + H(2)O
Cellular LocationMitochondrion
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB Reactions
2,3-Dihydroxyisovaleric acidAlpha-Ketoisovaleric acid + water
(R)-2,3-Dihydroxy-isovaleratewater + 3-Methylbutanoic acid
(R)-2,3-Dihydroxy-3-methylvaleratewater + (S)-3-methyl-2-oxovaleric acid
KEGG Reactions
(R)-2,3-Dihydroxy-isovalerateAlpha-Ketoisovaleric acid + water
(R)-2,3-Dihydroxy-3-methylvaleratewater + (S)-3-methyl-2-oxovaleric acid
Metabolites
YMDB IDNameView
YMDB00063(R)-2,3-Dihydroxy-isovalerateShow
YMDB00068(R)-2,3-Dihydroxy-3-methylvalerateShow
YMDB00168(S)-3-methyl-2-oxovaleric acidShow
YMDB00365Alpha-Ketoisovaleric acidShow
YMDB00890waterShow
YMDB016063-Methylbutanoic acidShow
YMDB162862,3-Dihydroxyisovaleric acidShow
GO Classification
Component
Not Available
Function
lyase activity
carbon-oxygen lyase activity
hydro-lyase activity
catalytic activity
dihydroxy-acid dehydratase activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular amino acid biosynthetic process
branched chain family amino acid biosynthetic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR016C
Gene Sequence>1758 bp ATGGGCTTGTTAACGAAAGTTGCTACATCTAGACAATTCTCTACAACGAGATGCGTTGCA AAGAAGCTCAACAAGTACTCGTATATCATCACTGAACCTAAGGGCCAAGGTGCGTCCCAG GCCATGCTTTATGCCACCGGTTTCAAGAAGGAAGATTTCAAGAAGCCTCAAGTCGGGGTT GGTTCCTGTTGGTGGTCCGGTAACCCATGTAACATGCATCTATTGGACTTGAATAACAGA TGTTCTCAATCCATTGAAAAAGCGGGTTTGAAAGCTATGCAGTTCAACACCATCGGTGTT TCAGACGGTATCTCTATGGGTACTAAAGGTATGAGATACTCGTTACAAAGTAGAGAAATC ATTGCAGACTCCTTTGAAACCATCATGATGGCACAACACTACGATGCTAACATCGCCATC CCATCATGTGACAAAAACATGCCCGGTGTCATGATGGCCATGGGTAGACATAACAGACCT TCCATCATGGTATATGGTGGTACTATCTTGCCCGGTCATCCAACATGTGGTTCTTCGAAG ATCTCTAAAAACATCGATATCGTCTCTGCGTTCCAATCCTACGGTGAATATATTTCCAAG CAATTCACTGAAGAAGAAAGAGAAGATGTTGTGGAACATGCATGCCCAGGTCCTGGTTCT TGTGGTGGTATGTATACTGCCAACACAATGGCTTCTGCCGCTGAAGTGCTAGGTTTGACC ATTCCAAACTCCTCTTCCTTCCCAGCCGTTTCCAAGGAGAAGTTAGCTGAGTGTGACAAC ATTGGTGAATACATCAAGAAGACAATGGAATTGGGTATTTTACCTCGTGATATCCTCACA AAAGAGGCTTTTGAAAACGCCATTACTTATGTCGTTGCAACCGGTGGGTCCACTAATGCT GTTTTGCATTTGGTGGCTGTTGCTCACTCTGCGGGTGTCAAGTTGTCACCAGATGATTTC CAAAGAATCAGTGATACTACACCATTGATCGGTGACTTCAAACCTTCTGGTAAATACGTC ATGGCCGATTTGATTAACGTTGGTGGTACCCAATCTGTGATTAAGTATCTATATGAAAAC AACATGTTGCACGGTAACACAATGACTGTTACCGGTGACACTTTGGCAGAACGTGCAAAG AAAGCACCAAGCCTACCTGAAGGACAAGAGATTATTAAGCCACTCTCCCACCCAATCAAG GCCAACGGTCACTTGCAAATTCTGTACGGTTCATTGGCACCAGGTGGAGCTGTGGGTAAA ATTACCGGTAAGGAAGGTACTTACTTCAAGGGTAGAGCACGTGTGTTCGAAGAGGAAGGT GCCTTTATTGAAGCCTTGGAAAGAGGTGAAATCAAGAAGGGTGAAAAAACCGTTGTTGTT ATCAGATATGAAGGTCCAAGAGGTGCACCAGGTATGCCTGAAATGCTAAAGCCTTCCTCT GCTCTGATGGGTTACGGTTTGGGTAAAGATGTTGCATTGTTGACTGATGGTAGATTCTCT GGTGGTTCTCACGGGTTCTTAATCGGCCACATTGTTCCCGAAGCCGCTGAAGGTGGTCCT ATCGGGTTGGTCAGAGACGGCGATGAGATTATCATTGATGCTGATAATAACAAGATTGAC CTATTAGTCTCTGATAAGGAAATGGCTCAACGTAAACAAAGTTGGGTTGCACCTCCACCT CGTTACACAAGAGGTACTCTATCCAAGTATGCTAAGTTGGTTTCCAACGCTTCCAACGGT TGTGTTTTAGATGCTTGA
Protein Properties
Pfam Domain Function
Protein Residues585
Protein Molecular Weight62860.60156
Protein Theoretical pI7.92
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dihydroxy-acid dehydratase, mitochondrial MGLLTKVATSRQFSTTRCVAKKLNKYSYIITEPKGQGASQAMLYATGFKKEDFKKPQVGV GSCWWSGNPCNMHLLDLNNRCSQSIEKAGLKAMQFNTIGVSDGISMGTKGMRYSLQSREI IADSFETIMMAQHYDANIAIPSCDKNMPGVMMAMGRHNRPSIMVYGGTILPGHPTCGSSK ISKNIDIVSAFQSYGEYISKQFTEEEREDVVEHACPGPGSCGGMYTANTMASAAEVLGLT IPNSSSFPAVSKEKLAECDNIGEYIKKTMELGILPRDILTKEAFENAITYVVATGGSTNA VLHLVAVAHSAGVKLSPDDFQRISDTTPLIGDFKPSGKYVMADLINVGGTQSVIKYLYEN NMLHGNTMTVTGDTLAERAKKAPSLPEGQEIIKPLSHPIKANGHLQILYGSLAPGGAVGK ITGKEGTYFKGRARVFEEEGAFIEALERGEIKKGEKTVVVIRYEGPRGAPGMPEMLKPSS ALMGYGLGKDVALLTDGRFSGGSHGFLIGHIVPEAAEGGPIGLVRDGDEIIIDADNNKID LLVSDKEMAQRKQSWVAPPPRYTRGTLSKYAKLVSNASNGCVLDA
References
External Links
ResourceLink
Saccharomyces Genome Database ILV3
Uniprot IDP39522
Uniprot NameILV3_YEAST
GenBank Gene IDX87611
Genebank Protein ID854590
General Reference
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Velasco, J. A., Cansado, J., Pena, M. C., Kawakami, T., Laborda, J., Notario, V. (1993). "Cloning of the dihydroxyacid dehydratase-encoding gene (ILV3) from Saccharomyces cerevisiae." Gene 137:179-185.8299945
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106