You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSphingolipid C4-hydroxylase SUR2
Synonyms
  • Syringomycin response protein 2
Gene NameSUR2
Enzyme Class
Biological Properties
General FunctionInvolved in iron ion binding
Specific FunctionRequired for hydroxylation of C-4 in the sphingoid moiety of ceramide. Involved in the response to syringomycin
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein (Probable)
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
Sphingolipid metabolismPW002479 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
Sphingolipid metabolismec00600 Map00600
SMPDB Reactions
hydron + oxygen + ferrocytochrome b5 + Sphinganinewater + Phytosphingosine + ferricytochrome b5
Sphinganine + Ferrocytochrome + oxygen + hydronPhytosphingosine + ferricytochrome c + water
4,4-Dimethyl-5a-cholesta-8,24-dien-3-b-ol + NADPH + oxygen → 4a-Methylzymosterol-4-carboxylic acid + NADP + water
KEGG Reactions
N-tetracosanoylsphinganine + NADPH + hydron + oxygenNADP + N-Tetracosanoylphytosphingosine + water
N-hexacosanylsphinganine + NADPH + hydron + oxygenNADP + N-Hexacosanoylphytosphingosine + water
Sphinganine + NADPH + hydron + oxygenNADP + Phytosphingosine + water
Metabolites
YMDB IDNameView
YMDB00285PhytosphingosineShow
YMDB002904,4-Dimethyl-5a-cholesta-8,24-dien-3-b-olShow
YMDB00327SphinganineShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00619N-tetracosanoylsphinganineShow
YMDB00621N-hexacosanylsphinganineShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB00963N-TetracosanoylphytosphingosineShow
YMDB00964N-HexacosanoylphytosphingosineShow
YMDB16255ferricytochrome cShow
GO Classification
Component
membrane-bounded organelle
intracellular membrane-bounded organelle
endoplasmic reticulum
organelle
Function
ion binding
cation binding
metal ion binding
transition metal ion binding
iron ion binding
oxidoreductase activity
catalytic activity
binding
Process
monocarboxylic acid metabolic process
fatty acid metabolic process
fatty acid biosynthetic process
oxidation reduction
organic acid metabolic process
metabolic process
oxoacid metabolic process
cellular metabolic process
carboxylic acid metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR297W
Gene Sequence>1050 bp ATGAACGTAACATCGAATGCAACTGCAGCCGGTTCCTTTCCACTAGCATTTGGTCTCAAG ACCTCATTTGGGTTTATGCACTATGCCAAGGCCCCTGCCATTAATTTACGCCCCAAGGAA TCCTTGCTGCCGGAAATGAGTGATGGTGTGCTGGCCTTGGTTGCGCCGGTTGTTGCCTAC TGGGCGTTGTCTGGTATATTCCATGTAATAGACACTTTCCATCTGGCTGAGAAGTACAGA ATTCATCCGAGCGAAGAGGTTGCCAAGAGGAACAAGGCGTCGAGAATGCATGTTTTCCTT GAAGTGATTCTACAACATATCATACAGACCATTGTTGGCCTTATCTTTATGCACTTCGAG CCGATCTACATGACTGGGTTTGAAGAAAATGCCATGTGGAAGCTTCGTGCAGACCTTCCT CGGATTATTCCAGATGCCGCTATTTATTACGGCTATATGTACGGAATGTCCGCTTTGAAG ATCTTTGCAGGCTTTTTATTCGTTGATACATGGCAATACTTTTTGCATAGATTGATGCAT ATGAATAAGACCTTATACAAATGGTTCCACTCTGTTCATCATGAACTATACGTGCCATAT GCTTACGGTGCTCTTTTCAACAATCCTGTTGAGGGCTTCTTGTTAGATACTTTGGGAACC GGTATTGCCATGACGTTAACTCATTTGACTCACAGAGAGCAAATCATTCTTTTTACCTTT GCCACCATGAAGACTGTCGATGACCACTGTGGGTATGCTTTGCCACTTGACCCATTCCAA TGGCTTTTCCCTAATAACGCTGTCTATCACGATATCCACCACCAGCAATTTGGTATCAAG ACGAACTTTGCTCAACCATTTTTCACTTTCTGGGACAATTTGTTCCAAACTAACTTTAAA GGGTTTGAAGAATATCAAAAGAAGCAAAGACGTGTCACCATCGACAAGTACAAAGAGTTT TTGCAAGAGAGAGAATTGGAAAAGAAGGAGAAACTCAAAAACTTCAAAGCTATGAATGCT GCTGAAAATGAAGTAAAGAAAGAGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues349
Protein Molecular Weight40734.0
Protein Theoretical pI8.73
Signalling Regions
  • None
Transmembrane Regions
  • 9-29
  • 50-70
  • 99-119
  • 148-168
  • 209-229
Protein Sequence>Sphingolipid C4-hydroxylase SUR2 MNVTSNATAAGSFPLAFGLKTSFGFMHYAKAPAINLRPKESLLPEMSDGVLALVAPVVAY WALSGIFHVIDTFHLAEKYRIHPSEEVAKRNKASRMHVFLEVILQHIIQTIVGLIFMHFE PIYMTGFEENAMWKLRADLPRIIPDAAIYYGYMYGMSALKIFAGFLFVDTWQYFLHRLMH MNKTLYKWFHSVHHELYVPYAYGALFNNPVEGFLLDTLGTGIAMTLTHLTHREQIILFTF ATMKTVDDHCGYALPLDPFQWLFPNNAVYHDIHHQQFGIKTNFAQPFFTFWDNLFQTNFK GFEEYQKKQRRVTIDKYKEFLQERELEKKEKLKNFKAMNAAENEVKKEK
References
External Links
ResourceLink
Saccharomyces Genome Database SUR2
Uniprot IDP38992
Uniprot NameSUR2_YEAST
GenBank Gene IDU07171
Genebank Protein ID458718
General Reference
  • Cliften, P., Wang, Y., Mochizuki, D., Miyakawa, T., Wangspa, R., Hughes, J., Takemoto, J. Y. (1996). "SYR2, a gene necessary for syringomycin growth inhibition of Saccharomyces cerevisiae." Microbiology 142 ( Pt 3):477-484.8868422
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Haak, D., Gable, K., Beeler, T., Dunn, T. (1997). "Hydroxylation of Saccharomyces cerevisiae ceramides requires Sur2p and Scs7p." J Biol Chem 272:29704-29710.9368039
  • Grilley, M. M., Stock, S. D., Dickson, R. C., Lester, R. L., Takemoto, J. Y. (1998). "Syringomycin action gene SYR2 is essential for sphingolipid 4-hydroxylation in Saccharomyces cerevisiae." J Biol Chem 273:11062-11068.9556590
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106