You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome c lysine N-methyltransferase 1
SynonymsNot Available
Gene NameCTM1
Enzyme Class
Biological Properties
General FunctionInvolved in [cytochrome c]-lysine N-methyltransferase a
Specific FunctionMethyltransferase which mediates trimethylation of Lys- 77 of cytochrome c (CYC1)
Cellular LocationCytoplasm, cytosol
SMPDB PathwaysNot Available
KEGG Pathways
Lysine degradationec00310 Map00310
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 8
LocusYHR109W
Gene Sequence>1758 bp ATGGAGGAAGTGTTCCGTTTTTACTCGAACTCTAGAAATATCTTCATTCATAAAAGCCTT TCATTAAAACCATCCACCATTGATGACCCCAAAAGTGGGTATGGCCTTTTCGTAGAACCT TCGAAGTTCAAGAATGATGAATTGAAAAGTGAAACTATCCAATTGCTCCGAATCCCTAAG CGCTGCACGTTTAATATAAACACACTTCTGGCTCTCTTGGGAGATGAGGACGAATTTTCC TCAAAGGAAGAATTTCAAAGAACTAATGACAAAATTAAGATTGCTCTTCGTGAAATAATG GCTCATCCGAATTTCAGTGTGTTCCTGACAGAAACAAATTTACTCATAATTTATTTCATG ATATTTCAAACTATTCGTAGTCGTTATGAGATTCCCGAAAATATCCAATATTATTTAGAA AATGTTTTAATGAGCATTGAAGTAGAAACAGCCATGGATTCTATTGAAAACTTAGCTACT GATTATGGACATTATCCACAGATTTTTGGCCTTCGAGAGACGCTAAATTTATTTAAAGAA CTGTTTCACGACGTCTTGAATTTAAGTGATATCAAACATCTTTATTCTGCAATAATTTCA CGTTGTTTAGAGATACCAGAAAGGGCCGATACCAAAAGTGAAGAATTCACGGTCCATTCT ACTTTAGTCCCTATTGTAGATTTTGCCAACCATGAAGGCACCCAAAAAAATGCTTATTTT GACATCGACCCTTCAAATAATGACGTTTTACTTCTATTGGATACAAGAGCGGTCCAAAGT GAACTCACAAAACCTATTGAAGTTTTCATTAGTTACTCACCAACAGAGGATTTATTTTCC ATGCTTGTAACATATGGATTCACCCCAGATTTTAGAGGGAATTCCCAATTTTGGACTGTA TCCTTTGACAGGTGCTTTTTAAGAAACTATGATGGACCAGATAAAACTACAAATTTAAGA TTGTTTTACAAATGGATGCACATAAATCCAGTGGTACCACTAGTTAAATACGAGCACAAC GGAAAGACTCGCTGGTTTCTCAATGACACCACGCCTGAATTTGATATGCTTTTGCTCCCA TTCATTCCATCGATAGATGATGGCAAAATTGCTCGGTGGGCGTACGATTCCACATGTCAT TTGATGTTCACGAAAATCCATTGTCTGATAAATCCCGAGGCCAACGAACATGCGTTAATG ATTGCAGAAAACTACCGCTCTCTCATTAAAGAGAAAGAGTCAAATGGTGACGATTTCATA AATTTACCGCCACTAGCTTGGTCATTGCGTTACAAAGATACAGAAAACGATTGTGTACGG CAAAGACATATATGCAGTGAAGATGCGGTCGCTGTACTTAAACAAGAAGAAATGCAAGAC TCAACCAAAACCAAATCCCAGTTTACCAGTTTCTTTCGTAAATTTTTAGAGTTTCGTAGA TCCAAAATTATTAGGCCTACCAGTGATTCAAAAGTTGCAAGCATATTATACCAGCAGGAA CTGGAAATAATTGCTGACTTAGCAAAAGCTATCGATAGCAGCTCTACCATTTTTTTCAGC GATCTGAATGTTACATTGGACACCGAACCAGAACGGCTCCCCCCTCTAAGGTTTTTAGAT GATTACATAGAGATCTCTGCGGATAAGCAGGAGCCAAGCCCAATTTGTGAGGATCTTTCT TATTATACACCCAGCAGGTTTACTGATTTTTTTCAAGAAGAGGTAAGCCAATATGCGGCT TTCTTTCAGGATGACTAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues585
Protein Molecular Weight68283.60156
Protein Theoretical pI4.62
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome c lysine N-methyltransferase 1 MEEVFRFYSNSRNIFIHKSLSLKPSTIDDPKSGYGLFVEPSKFKNDELKSETIQLLRIPK RCTFNINTLLALLGDEDEFSSKEEFQRTNDKIKIALREIMAHPNFSVFLTETNLLIIYFM IFQTIRSRYEIPENIQYYLENVLMSIEVETAMDSIENLATDYGHYPQIFGLRETLNLFKE LFHDVLNLSDIKHLYSAIISRCLEIPERADTKSEEFTVHSTLVPIVDFANHEGTQKNAYF DIDPSNNDVLLLLDTKAVQSELTKPIEVFISYSPTEDLFSMLVTYGFTPDFRGNSQFWTV SFDRCFLRNYDGPDKTTNLRLFYKWMHINPVVPLVKYEHNGKTRWFLNDTTPEFDMLLLP FIPSIDDGKIARWAYDSTCHLMFTKIHCLINPEANEHALMIAENYRSLIKEKESNGDDFI NLPPLAWSLRYKDTENDCVRQRHICSEDAVAVLKQEEMQDSTKTKSQFTSFFRKFLEFRR SKIIRPTSDSKVASILYQQELEIIADLAKAIDSSSTIFFSDLNVTLDTEPERLPPLRFLD DYIEISADKQEPSPICEDLSYYTPSRFTDFFQEEVSQYAAFFQDD
References
External Links
ResourceLink
Saccharomyces Genome Database CTM1
Uniprot IDP38818
Uniprot NameCTM1_YEAST
GenBank Gene IDAY723824
Genebank Protein ID51830380
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Polevoda, B., Martzen, M. R., Das, B., Phizicky, E. M., Sherman, F. (2000). "Cytochrome c methyltransferase, Ctm1p, of yeast." J Biol Chem 275:20508-20513.10791961
  • Porras-Yakushi, T. R., Whitelegge, J. P., Miranda, T. B., Clarke, S. (2005). "A novel SET domain methyltransferase modifies ribosomal protein Rpl23ab in yeast." J Biol Chem 280:34590-34598.16096273