You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThioredoxin reductase 2, mitochondrial
SynonymsNot Available
Gene NameTRR2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionActs on mitochondrial thioredoxin 3. Implicated in the defense against oxidative stress
Cellular LocationMitochondrion
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
Selenocompound metabolismec00450 Map00450
SMPDB Reactions
NADPH + hydron + Methylselenic acidmethylselenol + NADP + water
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB16312methylselenolShow
YMDB16313Methylselenic acidShow
GO Classification
Component
cytoplasm
cell part
intracellular part
Function
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
FAD or FADH2 binding
oxidoreductase activity
antioxidant activity
thioredoxin-disulfide reductase activity
catalytic activity
binding
Process
oxidation reduction
oxygen and reactive oxygen species metabolic process
superoxide metabolic process
removal of superoxide radicals
metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR106W
Gene Sequence>1029 bp ATGATAAAACATATAGTTTCGCCATTCAGGACGAATTTTGTTGGCATCAGCAAGTCCGTG CTGTCAAGGATGATTCATCACAAGGTTACAATCATAGGTTCTGGCCCCGCTGCCCACACC GCTGCTATATACTTGGCAAGAGCAGAGATGAAGCCCACATTATATGAGGGAATGATGGCC AACGGAATTGCTGCTGGTGGCCAATTGACAACAACCACCGATATCGAAAATTTCCCAGGG TTTCCTGAATCGTTGAGTGGCAGTGAACTGATGGAGAGGATGAGGAAACAATCTGCCAAG TTTGGCACTAACATAATTACCGAGACTGTCTCTAAAGTCGATTTATCTTCAAAACCATTC AGATTATGGACCGAATTTAATGAGGATGCAGAGCCTGTGACCACTGATGCTATAATCTTG GCCACGGGTGCTTCCGCTAAGAGAATGCATTTACCAGGGGAGGAAACCTACTGGCAGCAG GGAATATCTGCCTGTGCTGTATGTGATGGTGCAGTCCCTATCTTTAGAAACAAGCCATTG GCCGTTATTGGTGGTGGTGACTCTGCGTGTGAGGAAGCGGAATTTCTTACGAAGTATGCG TCGAAAGTATATATATTAGTAAGAAAGGATCATTTTCGTGCATCTGTAATAATGCAGAGA CGAATTGAGAAAAATCCAAACATCATTGTTTTGTTCAACACAGTTGCATTAGAAGCTAAG GGTGATGGTAAGTTATTGAATATGTTGAGAATTAAGAATACTAAAAGTAATGTGGAGAAC GATTTAGAAGTAAATGGACTATTTTACGCAATAGGTCACAGCCCTGCCACAGATATAGTT AAAGGACAAGTAGATGAAGAAGAGACGGGGTATATAAAAACTGTGCCTGGATCGTCTCTG ACTTCTGTGCCAGGTTTTTTTGCTGCAGGTGACGTTCAGGACTCTAGGTATAGACAAGCA GTTACTTCTGCTGGTTCCGGATGCATTGCTGCTTTGGATGCAGAACGGTACCTAAGTGCC CAAGAGTAA
Protein Properties
Pfam Domain Function
Protein Residues342
Protein Molecular Weight37087.0
Protein Theoretical pI6.88
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Thioredoxin reductase 2, mitochondrial MIKHIVSPFRTNFVGISKSVLSRMIHHKVTIIGSGPAAHTAAIYLARAEMKPTLYEGMMA NGIAAGGQLTTTTDIENFPGFPESLSGSELMERMRKQSAKFGTNIITETVSKVDLSSKPF RLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQQGISACAVCDGAVPIFRNKPL AVIGGGDSACEEAEFLTKYASKVYILVRKDHFRASVIMQRRIEKNPNIIVLFNTVALEAK GDGKLLNMLRIKNTKSNVENDLEVNGLFYAIGHSPATDIVKGQVDEEETGYIKTVPGSSL TSVPGFFAAGDVQDSRYRQAVTSAGSGCIAALDAERYLSAQE
References
External Links
ResourceLink
Saccharomyces Genome Database TRR2
Uniprot IDP38816
Uniprot NameTRXB2_YEAST
GenBank Gene IDAY557882
Genebank Protein ID45269655
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Pedrajas, J. R., Kosmidou, E., Miranda-Vizuete, A., Gustafsson, J. A., Wright, A. P., Spyrou, G. (1999). "Identification and functional characterization of a novel mitochondrial thioredoxin system in Saccharomyces cerevisiae." J Biol Chem 274:6366-6373.10037727
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106