You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphogluconate dehydrogenase, decarboxylating 1
SynonymsNot Available
Gene NameGND1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the oxidative decarboxylation of 6- phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH
Cellular LocationCytoplasm
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
Pentose phosphate pathwayec00030 Map00030
SMPDB ReactionsNot Available
KEGG Reactions
6-Phosphogluconic acid + NADPCarbon dioxide + NADPH + D-ribulose 5-phosphate
Metabolites
YMDB IDNameView
YMDB002186-Phosphogluconic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00912Carbon dioxideShow
YMDB00948D-ribulose 5-phosphateShow
GO Classification
Component
Not Available
Function
binding
phosphogluconate dehydrogenase (decarboxylating) activity
nucleotide binding
oxidoreductase activity
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
NADP or NADPH binding
coenzyme binding
catalytic activity
Process
metabolic process
glucose catabolic process
pentose-phosphate shunt
oxidation reduction
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR183W
Gene Sequence>1470 bp ATGTCTGCTGATTTCGGTTTGATTGGTTTGGCCGTCATGGGTCAAAATTTGATCTTGAAC GCTGCTGACCACGGTTTCACTGTTTGTGCTTACAACAGAACTCAATCCAAGGTCGACCAT TTCTTGGCCAATGAAGCTAAGGGCAAATCTATCATCGGTGCTACTTCCATTGAAGATTTC ATCTCCAAATTGAAGAGACCTAGAAAGGTCATGCTTTTGGTTAAAGCTGGTGCTCCAGTT GACGCTTTGATCAACCAAATCGTCCCACTTTTGGAAAAGGGTGATATTATCATCGATGGT GGTAACTCTCACTTCCCAGATTCTAATAGACGTTACGAAGAATTGAAGAAGAAGGGTATT CTTTTCGTTGGTTCTGGTGTCTCCGGTGGTGAGGAAGGTGCCCGTTACGGTCCATCTTTG ATGCCAGGTGGTTCTGAAGAAGCTTGGCCACATATTAAGAACATCTTCCAATCCATCTCT GCTAAATCCGACGGTGAACCATGTTGCGAATGGGTTGGCCCAGCCGGTGCTGGTCACTAC GTCAAGATGGTTCACAACGGTATTGAATACGGTGATATGCAATTGATTTGTGAAGCTTAT GACATCATGAAGAGATTGGGTGGGTTTACCGATAAGGAAATCAGTGACGTTTTTGCCAAA TGGAACAATGGTGTCTTGGATTCCTTCTTGGTCGAAATTACCAGAGATATTTTGAAATTC GACGACGTCGACGGTAAGCCATTAGTTGAAAAAATCATGGATACTGCTGGTCAAAAGGGT ACTGGTAAGTGGACTGCCATCAACGCCTTGGATTTGGGTATGCCAGTTACTTTGATTGGT GAAGCTGTCTTTGCCCGTTGTCTATCTGCTTTGAAGAACGAGAGAATTAGAGCCTCCAAG GTCTTACCAGGCCCAGAAGTTCCAAAAGACGCCGTCAAGGACAGAGAACAATTTGTCGAT GATTTGGAACAAGCTTTGTATGCTTCCAAGATTATTTCTTACGCTCAAGGTTTCATGTTG ATCCGTGAAGCTGCTGCTACTTATGGCTGGAAACTAAACAACCCTGCCATCGCTTTGATG TGGAGAGGTGGTTGTATCATTAGATCTGTTTTCTTGGGTCAAATCACAAAGGCCTACAGA GAAGAACCAGATTTGGAAAACTTGTTGTTCAACAAGTTCTTCGCTGATGCCGTCACCAAG GCTCAATCTGGTTGGAGAAAGTCAATTGCGTTGGCTACCACCTACGGTATCCCAACACCA GCCTTTTCCACCGCTTTGTCTTTCTACGATGGGTACAGATCTGAAAGATTGCCAGCCAAC TTACTACAAGCTCAACGTGACTACTTTGGTGCTCACACTTTCAGAGTGTTGCCAGAATGT GCTTCTGACAACTTGCCAGTAGACAAGGATATCCATATCAACTGGACTGGCCACGGTGGT AATGTTTCTTCCTCTACATACCAAGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues489
Protein Molecular Weight53542.69922
Protein Theoretical pI6.6
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphogluconate dehydrogenase, decarboxylating 1 MSADFGLIGLAVMGQNLILNAADHGFTVCAYNRTQSKVDHFLANEAKGKSIIGATSIEDF ISKLKRPRKVMLLVKAGAPVDALINQIVPLLEKGDIIIDGGNSHFPDSNRRYEELKKKGI LFVGSGVSGGEEGARYGPSLMPGGSEEAWPHIKNIFQSISAKSDGEPCCEWVGPAGAGHY VKMVHNGIEYGDMQLICEAYDIMKRLGGFTDKEISDVFAKWNNGVLDSFLVEITRDILKF DDVDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSALKNERIRASK VLPGPEVPKDAVKDREQFVDDLEQALYASKIISYAQGFMLIREAAATYGWKLNNPAIALM WRGGCIIRSVFLGQITKAYREEPDLENLLFNKFFADAVTKAQSGWRKSIALATTYGIPTP AFSTALSFYDGYRSERLPANLLQAQRDYFGAHTFRVLPECASDNLPVDKDIHINWTGHGG NVSSSTYQA
References
External Links
ResourceLink
Saccharomyces Genome Database GND1
Uniprot IDP38720
Uniprot Name6PGD1_YEAST
GenBank Gene IDU00028
Genebank Protein ID458910
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Garrels, J. I., Futcher, B., Kobayashi, R., Latter, G. I., Schwender, B., Volpe, T., Warner, J. R., McLaughlin, C. S. (1994). "Protein identifications for a Saccharomyces cerevisiae protein database." Electrophoresis 15:1466-1486.7895733
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • He, W., Wang, Y., Liu, W., Zhou, C. Z. (2007). "Crystal structure of Saccharomyces cerevisiae 6-phosphogluconate dehydrogenase Gnd1." BMC Struct Biol 7:38.17570834