You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphogluconate dehydrogenase, decarboxylating 1
SynonymsNot Available
Gene NameGND1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the oxidative decarboxylation of 6- phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH
Cellular LocationCytoplasm
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
Pentose phosphate pathwayec00030 Map00030
SMPDB ReactionsNot Available
KEGG Reactions
6-Phosphogluconic acid + NADPCarbon dioxide + NADPH + D-ribulose 5-phosphate
Metabolites
YMDB IDNameView
YMDB002186-Phosphogluconic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00912Carbon dioxideShow
YMDB00948D-ribulose 5-phosphateShow
GO Classification
Component
Not Available
Function
nucleotide binding
oxidoreductase activity
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
NADP or NADPH binding
coenzyme binding
catalytic activity
binding
phosphogluconate dehydrogenase (decarboxylating) activity
Process
oxidation reduction
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
metabolic process
glucose catabolic process
pentose-phosphate shunt
Gene Properties
Chromosome Locationchromosome 8
LocusYHR183W
Gene Sequence>1470 bp ATGTCTGCTGATTTCGGTTTGATTGGTTTGGCCGTCATGGGTCAAAATTTGATCTTGAAC GCTGCTGACCACGGTTTCACTGTTTGTGCTTACAACAGAACTCAATCCAAGGTCGACCAT TTCTTGGCCAATGAAGCTAAGGGCAAATCTATCATCGGTGCTACTTCCATTGAAGATTTC ATCTCCAAATTGAAGAGACCTAGAAAGGTCATGCTTTTGGTTAAAGCTGGTGCTCCAGTT GACGCTTTGATCAACCAAATCGTCCCACTTTTGGAAAAGGGTGATATTATCATCGATGGT GGTAACTCTCACTTCCCAGATTCTAATAGACGTTACGAAGAATTGAAGAAGAAGGGTATT CTTTTCGTTGGTTCTGGTGTCTCCGGTGGTGAGGAAGGTGCCCGTTACGGTCCATCTTTG ATGCCAGGTGGTTCTGAAGAAGCTTGGCCACATATTAAGAACATCTTCCAATCCATCTCT GCTAAATCCGACGGTGAACCATGTTGCGAATGGGTTGGCCCAGCCGGTGCTGGTCACTAC GTCAAGATGGTTCACAACGGTATTGAATACGGTGATATGCAATTGATTTGTGAAGCTTAT GACATCATGAAGAGATTGGGTGGGTTTACCGATAAGGAAATCAGTGACGTTTTTGCCAAA TGGAACAATGGTGTCTTGGATTCCTTCTTGGTCGAAATTACCAGAGATATTTTGAAATTC GACGACGTCGACGGTAAGCCATTAGTTGAAAAAATCATGGATACTGCTGGTCAAAAGGGT ACTGGTAAGTGGACTGCCATCAACGCCTTGGATTTGGGTATGCCAGTTACTTTGATTGGT GAAGCTGTCTTTGCCCGTTGTCTATCTGCTTTGAAGAACGAGAGAATTAGAGCCTCCAAG GTCTTACCAGGCCCAGAAGTTCCAAAAGACGCCGTCAAGGACAGAGAACAATTTGTCGAT GATTTGGAACAAGCTTTGTATGCTTCCAAGATTATTTCTTACGCTCAAGGTTTCATGTTG ATCCGTGAAGCTGCTGCTACTTATGGCTGGAAACTAAACAACCCTGCCATCGCTTTGATG TGGAGAGGTGGTTGTATCATTAGATCTGTTTTCTTGGGTCAAATCACAAAGGCCTACAGA GAAGAACCAGATTTGGAAAACTTGTTGTTCAACAAGTTCTTCGCTGATGCCGTCACCAAG GCTCAATCTGGTTGGAGAAAGTCAATTGCGTTGGCTACCACCTACGGTATCCCAACACCA GCCTTTTCCACCGCTTTGTCTTTCTACGATGGGTACAGATCTGAAAGATTGCCAGCCAAC TTACTACAAGCTCAACGTGACTACTTTGGTGCTCACACTTTCAGAGTGTTGCCAGAATGT GCTTCTGACAACTTGCCAGTAGACAAGGATATCCATATCAACTGGACTGGCCACGGTGGT AATGTTTCTTCCTCTACATACCAAGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues489
Protein Molecular Weight53542.69922
Protein Theoretical pI6.6
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphogluconate dehydrogenase, decarboxylating 1 MSADFGLIGLAVMGQNLILNAADHGFTVCAYNRTQSKVDHFLANEAKGKSIIGATSIEDF ISKLKRPRKVMLLVKAGAPVDALINQIVPLLEKGDIIIDGGNSHFPDSNRRYEELKKKGI LFVGSGVSGGEEGARYGPSLMPGGSEEAWPHIKNIFQSISAKSDGEPCCEWVGPAGAGHY VKMVHNGIEYGDMQLICEAYDIMKRLGGFTDKEISDVFAKWNNGVLDSFLVEITRDILKF DDVDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSALKNERIRASK VLPGPEVPKDAVKDREQFVDDLEQALYASKIISYAQGFMLIREAAATYGWKLNNPAIALM WRGGCIIRSVFLGQITKAYREEPDLENLLFNKFFADAVTKAQSGWRKSIALATTYGIPTP AFSTALSFYDGYRSERLPANLLQAQRDYFGAHTFRVLPECASDNLPVDKDIHINWTGHGG NVSSSTYQA
References
External Links
ResourceLink
Saccharomyces Genome Database GND1
Uniprot IDP38720
Uniprot Name6PGD1_YEAST
GenBank Gene IDU00028
Genebank Protein ID458910
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Garrels, J. I., Futcher, B., Kobayashi, R., Latter, G. I., Schwender, B., Volpe, T., Warner, J. R., McLaughlin, C. S. (1994). "Protein identifications for a Saccharomyces cerevisiae protein database." Electrophoresis 15:1466-1486.7895733
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • He, W., Wang, Y., Liu, W., Zhou, C. Z. (2007). "Crystal structure of Saccharomyces cerevisiae 6-phosphogluconate dehydrogenase Gnd1." BMC Struct Biol 7:38.17570834