You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable UTP--glucose-1-phosphate uridylyltransferase
Synonyms
  • UDP-glucose pyrophosphorylase
  • UDPGP
  • UGPase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotidyltransferase activity
Specific FunctionPlays a central role as a glucosyl donor in cellular metabolic pathways
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Leloir PathwayPW002397 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Galactose metabolismec00052 Map00052
Pentose and glucuronate interconversionsec00040 Map00040
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Glucose 1-phosphate + Uridine triphosphateUridine diphosphate glucose + Pyrophosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00219PyrophosphateShow
YMDB00288Glucose 1-phosphateShow
YMDB00326Uridine triphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00970alpha-D-glucose 1-phosphateShow
GO Classification
Component
Not Available
Function
nucleotidyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYHL012W
Gene Sequence>1482 bp ATGACGGTTTTCTCTGGAGTAAATAAAATAGAGTTTGAAGGTACTTTCGAAGGTATTGGA AAGGATGTTGTTATGTCACAAATGATAAGGGCCTTGCAGAAACATTTTCCTTCGATACGT GACAAGAATTATGAGTTTAGCCTATTTTTGCACATTTTTCAAAGATATGTCTTAGAAAAT ACTTCAATCACCCATGATCTAGTTTGTGACAAAATTAGATTACCGATAATTGATGAAGTG GTTGAACTCGATGATATTAAAAATTACGGTTTGTTAGAGGGTAAACTATTATCAAAGTTA GCTATTTTAAAATTAACCGGAAAGGCTAATCCAATCATTGGTAAAGAAAGCCCTTTATTC GAAGTAAAAAATGGGATGTCTTCATTGGATGTAATAGTTCGACAAACGCAAAATTTGAAT GTACGATATAATTCAGACGTTCCTCTTATATTTATGACCTCGCTTGAAACTGAATCTCAA GTATCAAACTTCCTTGAAGAGCATTATTCTTCTAGCAAAGTGAGATGGAAAACCGTAGTT CAGTCAAGCTTTCCACAAATTGATAAAGATAGATTATTACCTATCGATTTACAAATAAAT TCTCATGAAAATGATTTTTGGTATCCTTGCGGGACTGGTAACCTAACTGACACTTTGTAT TTTTCAGGAGAATTGGACAAATTAATTGCTCAAGGAAAAGAGATTTTATTTGTTTCAAAT GTTGACAATTTGGGCGCTACAGGAGATTTGAACATTTTAAATTTCATCATAAATGAAAAA ATCGAGTATCTTGTTGAAGTAGTTGAAAGGACTGCAAATGTTTCAAACACTGGAGTGTTG GCAACATATAAAGGTAAACTACGATCGGTTTATTACAACTGCTTATCCAATGAAAGTGCA AGCACGTGTCGAATTGTCAACACTAATAACATTTGGATTGATTTGAAAAAGCTAAAGGTG CTAATAGAGTCTAATAGTTTAAATTTGCCAATTCATTCTAGTGAAAGTAAAATAACACAC AAAAATGAAGAGATAGAGTGTCTTCAATTTAAGACACAGTTGGTCGATTGTATTGCCTTC TTTCCGAACAGTCGAGTATTGAAAGTATCAAGAGACAGATTTTTACCCCTAAGAACATGT AAGGACTTGTTTTTGTTGAAATCAACATTATATGATCTCGATTCAAATGGAACATTTAAC CTCTACCCTCTGAAATTTGGATTATTACCTTCAATCGACTTGGGCGATGAGTTTGCAACT TATGAGACTTTTAAGATAGGAGTACCAGATATTCCTAATATTCTGGAATTAGAGCATTTA ACTGTGATGGGAAATGTGTTTTTTGGTCGTAATATAACTCTGAAAGGGACGGTCATTATA ATATGTGATGAAAATGATGTAATTACTGTTCCCGATGGCTCTATTTTGGAAAATGTAACG ATTTGGCATAAATCTCAGCTGGAGGATATGAATGGATATTAA
Protein Properties
Pfam Domain Function
Protein Residues493
Protein Molecular Weight55999.80078
Protein Theoretical pI4.98
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable UTP--glucose-1-phosphate uridylyltransferase MTVFSGVNKIEFEGTFEGIGKDVVMSQMIRALQKHFPSIRDKNYEFSLFLHIFQRYVLEN TSITHDLVCDKIRLPIIDEVVELDDIKNYGLLEGKLLSKLAILKLTGKANPIIGKESPLF EVKNGMSSLDVIVRQTQNLNVRYNSDVPLIFMTSLETESQVSNFLEEHYSSSKVRWKTVV QSSFPQIDKDRLLPIDLQINSHENDFWYPCGTGNLTDTLYFSGELDKLIAQGKEILFVSN VDNLGATGDLNILNFIINEKIEYLVEVVERTANVSNTGVLATYKGKLRSVYYNCLSNESA STCRIVNTNNIWIDLKKLKVLIESNSLNLPIHSSESKITHKNEEIECLQFKTQLVDCIAF FPNSRVLKVSRDRFLPLRTCKDLFLLKSTLYDLDSNGTFNLYPLKFGLLPSIDLGDEFAT YETFKIGVPDIPNILELEHLTVMGNVFFGRNITLKGTVIIICDENDVITVPDGSILENVT IWHKSQLEDMNGY
References
External Links
ResourceLink
Saccharomyces Genome Database YHL012W
Uniprot IDP38709
Uniprot NameUGPA2_YEAST
GenBank Gene IDU11582
Genebank Protein ID2289882
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229