You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3-ketodihydrosphingosine reductase TSC10
Synonyms
  • 3-dehydrosphinganine reductase
  • KDS reductase
  • Temperature-sensitive CSG2 suppressor protein 10
Gene NameTSC10
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS)
Cellular LocationEndoplasmic reticulum membrane; Single-pass membrane protein (Potential)
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
Sphingolipid metabolismPW002479 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
Sphingolipid metabolismec00600 Map00600
SMPDB Reactions
hydron + NADPH + 3-DehydrosphinganineNADP + Sphinganine
KEGG Reactions
3-Dehydrosphinganine + NADPH + hydronSphinganine + NADP
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB001833-DehydrosphinganineShow
YMDB00327SphinganineShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
binding
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR265W
Gene Sequence>963 bp ATGAAGTTTACGTTAGAAGACCAAGTTGTGTTGATCACTGGTGGTTCACAAGGTCTTGGA AAGGAATTCGCCAAAAAATATTATAATGAGGCTGAAAACACAAAGATTATTATCGTCAGT AGGTCAGAGGCTAGACTGCTGGACACATGCAACGAAATTAGGATTGAAGCTCACCTGAGA AGGGAAACCACTGACGAGGGCCAAGTGCAACATAAGTTGGCTGCGCCCTTGGACCTTGAG CAACGGTTATTTTACTACCCATGCGACTTGTCCTGCTACGAATCCGTGGAATGTTTGTTC AATGCCCTGAGAGACTTGGATTTACTCCCTACACAAACGTTATGCTGTGCAGGGGGGGCT GTTCCTAAGTTATTTCGTGGGCTAAGCGGACATGAGTTGAACTTGGGTATGGACATCAAC TATAAAACAACTTTGAACGTGGCACATCAGATTGCCCTTGCAGAGCAAACCAAGGAACAC CACCTCATCATCTTTTCTAGTGCCACCGCGCTTTACCCATTTGTGGGCTATTCCCAGTAT GCGCCTGCAAAAGCTGCAATCAAATCACTGGTAGCAATCTTAAGACAAGAACTGACGAAC TTCCGTATCAGTTGTGTTTATCCTGGTAATTTTGAAAGCGAAGGTTTCACTGTAGAGCAG CTAACGAAACCCGAAATTACAAAGTTGATCGAAGGCCCCTCAGACGCTATCCCATGCAAA CAAGCATGTGATATCATTGCCAAGTCGCTGGCCAGAGGTGATGAAGACGTTTTTACAGAT TTTGTCGGATGGATGATAATGGGGATGGACCTTGGGCTCACCGCAAAGAAAAGCCGCTTT GTTCCGTTGCAATGGATTTTTGGTGTCCTATCAAACATTCTGGTCGTGCCATTCTACATG GTTGGCTGTTCCTGGTATATCAGGAAATGGTTTCGTGAAAATGACGGCAAGAAGGCCAAC TGA
Protein Properties
Pfam Domain Function
Protein Residues320
Protein Molecular Weight35986.19922
Protein Theoretical pI6.25
Signalling Regions
  • None
Transmembrane Regions
  • 280-300
Protein Sequence>3-ketodihydrosphingosine reductase TSC10 MKFTLEDQVVLITGGSQGLGKEFAKKYYNEAENTKIIIVSRSEARLLDTCNEIRIEAHLR RETTDEGQVQHKLAAPLDLEQRLFYYPCDLSCYESVECLFNALRDLDLLPTQTLCCAGGA VPKLFRGLSGHELNLGMDINYKTTLNVAHQIALAEQTKEHHLIIFSSATALYPFVGYSQY APAKAAIKSLVAILRQELTNFRISCVYPGNFESEGFTVEQLTKPEITKLIEGPSDAIPCK QACDIIAKSLARGDEDVFTDFVGWMIMGMDLGLTAKKSRFVPLQWIFGVLSNILVVPFYM VGCSWYIRKWFRENDGKKAN
References
External Links
ResourceLink
Saccharomyces Genome Database TSC10
Uniprot IDP38342
Uniprot NameTSC10_YEAST
GenBank Gene IDX70529
Genebank Protein ID296564
General Reference
  • Doignon, F., Biteau, N., Crouzet, M., Aigle, M. (1993). "The complete sequence of a 19,482 bp segment located on the right arm of chromosome II from Saccharomyces cerevisiae." Yeast 9:189-199.8465606
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Beeler, T., Bacikova, D., Gable, K., Hopkins, L., Johnson, C., Slife, H., Dunn, T. (1998). "The Saccharomyces cerevisiae TSC10/YBR265w gene encoding 3-ketosphinganine reductase is identified in a screen for temperature-sensitive suppressors of the Ca2+-sensitive csg2Delta mutant." J Biol Chem 273:30688-30694.9804843
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106