You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameKynurenine 3-monooxygenase
Synonyms
  • Biosynthesis of nicotinic acid protein 4
  • Kynurenine 3-hydroxylase
Gene NameBNA4
Enzyme Class
Biological Properties
General FunctionInvolved in monooxygenase activity
Specific FunctionCatalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid
Cellular LocationMitochondrion
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
hydron + NADPH + oxygen + L-KynurenineL-3-Hydroxykynurenine + NADP + water
KEGG Reactions
L-Kynurenine + NADPH + hydron + oxygenNADP + L-3-Hydroxykynurenine + water
Metabolites
YMDB IDNameView
YMDB00105L-3-HydroxykynurenineShow
YMDB00110NADShow
YMDB00375L-KynurenineShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00900oxygenShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
monooxygenase activity
catalytic activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 2
LocusYBL098W
Gene Sequence>1383 bp ATGTCTGAATCAGTGGCCATTATAGGTGCAGGATTAGTAGGCTGCCTTGCAGCTTTGGCA TTCTCCAAAGAAGGCTACAATGTCACACTATATGATTTTAGACAAGATCCTCGATTGGAC ACCACCAAAAATAAAAATTTGAAATCCATTAATTTGGCTATTTCTGCTCGTGGCATTGAT GCTCTGAAATCAATAGATCCGGATGCTTGTGAACATATTCTGCAAGATATGATTCCCATG AAAGGCAGGATGATTCATGACTTGAAAGGCAGACAGGAATCACAATTGTATGGCTTGCAT GGAGAAGCTATTAATTCTATCAATAGATCTGTATTAAATAATAGCCTTTTGGACGAATTA GAAAAATCTACAACAGAACTGAAGTTCGGTCACAAATTAGTCAAAATCGAATGGACAGAT GATAAACAAATCTGTCATTTTGCCATTGGGGAAGATTTGAAAACCCCACATACTGAAAAG TATGATTTTGTCATAGGTTGTGACGGAGCATACTCTGCGACGAGATCGCAAATGCAACGT AAAGTTGAGATGGATTTTTCACAAGAATATATGAATTTACGTTACATTGAACTTTACATC CCGCCTACTGAGGAATTCAAGCCAAACTATGGCGGAAATTTTGCAATAGCTCCTGACCAT TTGCACATTTGGCCTCGTCATAAATTCATGTTAATTGCGCTCGCCAACAGTGACGGCTCG TTCACTTCAACCTTTTTCGGTTCTAAAGATCAAATATCAGATCTGATAACTTCCAAGTCA CGTGTGAGGGAATTCTTAATCGAGAACTTTCCCGATATTATTAATATTATGGATTTGGAC GATGCTGTCAAAAGGTTTATCACTTATCCAAAGGAAAGTCTTGTCTGTGTAAACTGTAAG CCATACGATGTACCAGGCGGAAAGGCCATCCTACTCGGCGACGCTGCCCATGCAATGGTT CCATTTTACGGCCAAGGTATGAATTGCGGATTTGAAGATGTGAGAATTCTTATGGCGCTA TTGAAAAAGCATTCAGGAGATCGTTCAAGAGCCTTTACTGAGTACACTCAAACAAGACAT AAGGACCTAGTTTCTATTACTGAGCTGGCAAAAAGGAACTATAAAGAAATGTCACATGAC GTTACATCCAAGCGGTTTTTATTAAGGAAAAAGCTAGATGCTCTCTTTAGTATTATAATG AAGGATAAGTGGATACCTTTGTATACAATGATATCTTTCAGATCCGATATCTCGTATTCT AGAGCTTTAGAAAGGGCTGGAAAGCAAACACGTATCTTGAAATTCTTAGAATCTCTGACA CTCGGTATGTTATCTATTGGCGGTTACAAGCTTTTCAAATTTTTGACAAGAGAACGTTCC TGA
Protein Properties
Pfam Domain Function
Protein Residues460
Protein Molecular Weight52428.89844
Protein Theoretical pI8.59
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Kynurenine 3-monooxygenase MSESVAIIGAGLVGCLAALAFSKEGYNVTLYDFRQDPRLDTTKNKNLKSINLAISARGID ALKSIDPDACEHILQDMIPMKGRMIHDLKGRQESQLYGLHGEAINSINRSVLNNSLLDEL EKSTTELKFGHKLVKIEWTDDKQICHFAIGEDLKTPHTEKYDFVIGCDGAYSATRSQMQR KVEMDFSQEYMNLRYIELYIPPTEEFKPNYGGNFAIAPDHLHIWPRHKFMLIALANSDGS FTSTFFGSKDQISDLITSKSRVREFLIENFPDIINIMDLDDAVKRFITYPKESLVCVNCK PYDVPGGKAILLGDAAHAMVPFYGQGMNCGFEDVRILMALLKKHSGDRSRAFTEYTQTRH KDLVSITELAKRNYKEMSHDVTSKRFLLRKKLDALFSIIMKDKWIPLYTMISFRSDISYS RALERAGKQTRILKFLESLTLGMLSIGGYKLFKFLTRERS
References
External Links
ResourceLink
Saccharomyces Genome Database BNA4
Uniprot IDP38169
Uniprot NameKMO_YEAST
GenBank Gene IDAY692951
Genebank Protein ID51013353
General Reference
  • Obermaier, B., Gassenhuber, J., Piravandi, E., Domdey, H. (1995). "Sequence analysis of a 78.6 kb segment of the left end of Saccharomyces cerevisiae chromosome II." Yeast 11:1103-1112.7502586
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Panozzo, C., Nawara, M., Suski, C., Kucharczyka, R., Skoneczny, M., Becam, A. M., Rytka, J., Herbert, C. J. (2002). "Aerobic and anaerobic NAD+ metabolism in Saccharomyces cerevisiae." FEBS Lett 517:97-102.12062417
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Giorgini, F., Guidetti, P., Nguyen, Q., Bennett, S. C., Muchowski, P. J. (2005). "A genomic screen in yeast implicates kynurenine 3-monooxygenase as a therapeutic target for Huntington disease." Nat Genet 37:526-531.15806102