You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameD-arabinose dehydrogenase [NAD(P)+] heavy chain
Synonyms
  • AKR3C
Gene NameARA1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the oxidation of D-arabinose, L-xylose, L- fucose and L-galactose in the presence of NADP+
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
NADP + D-ArabinoseD-arabinono-1,4-lactone + NADPH + hydron
Metabolites
YMDB IDNameView
YMDB00014D-arabinono-1,4-lactoneShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00654D-ArabinoseShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR149W
Gene Sequence>1035 bp ATGTCTTCTTCAGTAGCCTCAACCGAAAACATAGTCGAAAATATGTTGCATCCAAAGACT ACAGAAATATACTTTTCACTCAACAATGGTGTTCGTATCCCAGCACTGGGTTTGGGGACA GCAAATCCTCACGAAAAGTTAGCTGAAACAAAACAAGCCGTAAAAGCTGCAATCAAAGCT GGATACAGGCACATTGATACTGCTTGGGCCTACGAGACAGAGCCATTCGTAGGTGAAGCC ATCAAGGAGTTATTAGAAGATGGATCTATCAAAAGGGAGGATCTTTTCATAACCACAAAA GTGTGGCCGGTTCTATGGGACGAAGTGGACAGATCATTGAATGAATCTTTGAAAGCTTTA GGCTTGGAATACGTCGACTTGCTCTTGCAACATTGGCCGCTATGTTTTGAAAAGATTAAG GACCCTAAGGGGATCAGCGGACTGGTGAAGACTCCGGTTGATGATTCTGGAAAAACAATG TATGCTGCCGACGGTGACTATTTAGAAACTTACAAGCAATTGGAAAAAATTTACCTTGAT CCTAACGATCATCGTGTGAGAGCCATTGGTGTCTCAAATTTTTCCATTGAGTATTTGGAA CGTCTCATTAAGGAATGCAGAGTTAAGCCAACGGTGAACCAAGTGGAAACTCACCCTCAC TTACCACAAATGGAACTAAGAAAGTTCTGCTTTATGCACGACATTCTGTTAACAGCATAC TCACCATTAGGTTCCCATGGCGCACCAAACTTGAAAATCCCACTAGTGAAAAAGCTTGCC GAAAAGTACAATGTCACAGGAAATGACTTGCTAATTTCTTACCATATTAGACAAGGCACT ATCGTAATTCCGAGATCCTTGAATCCAGTTAGGATTTCCTCGAGTATTGAATTCGCATCT TTGACAAAGGATGAATTACAAGAGTTGAACGACTTCGGTGAAAAATACCCAGTGAGATTC ATCGATGAGCCATTTGCAGCCATCCTTCCAGAGTTTACTGGTAACGGACCAAACTTGGAC AATTTAAAGTATTAA
Protein Properties
Pfam Domain Function
Protein Residues344
Protein Molecular Weight38883.19922
Protein Theoretical pI5.83
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>D-arabinose dehydrogenase [NAD(P)+] heavy chain MSSSVASTENIVENMLHPKTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKA GYRHIDTAWAYETEPFVGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKAL GLEYVDLLLQHWPLCFEKIKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLD PNDHRVRAIGVSNFSIEYLERLIKECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAY SPLGSHGAPNLKIPLVKKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFAS LTKDELQELNDFGEKYPVRFIDEPFAAILPEFTGNGPNLDNLKY
References
External Links
ResourceLink
Saccharomyces Genome Database ARA1
Uniprot IDP38115
Uniprot NameARA1_YEAST
GenBank Gene IDZ36018
Genebank Protein ID536474
General Reference
  • Martinez-Soriano, J. P., Wong, W. M., Van Ryk, D. I., Nazar, R. N. (1991). "A widely distributed "CAT" family of repetitive DNA sequences." J Mol Biol 217:629-635.2005616
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Kim, S. T., Huh, W. K., Lee, B. H., Kang, S. O. (1998). "D-arabinose dehydrogenase and its gene from Saccharomyces cerevisiae." Biochim Biophys Acta 1429:29-39.9920381
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956