You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGeneral amino acid permease AGP2
SynonymsNot Available
Gene NameAGP2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionGeneral amino acid permease with broad substrate specificity. Can also transport carnitine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00232SpermidineShow
YMDB00616(R)-CarnitineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 2
LocusYBR132C
Gene Sequence>1791 bp ATGACAAAGGAACGTATGACCATCGACTACGAAAATGACGGTGATTTTGAGTACGATAAG AATAAATACAAGACAATAACCACTCGAATAAAGAGTATCGAACCTAGTGAGGGATGGTTG GAACCTTCTGGGTCAGTGGGTCACATAAACACGATACCCGAAGCGGGCGATGTTCACGTG GATGAACATGAGGATAGAGGGTCTTCTATTGATGATGACTCAAGGACTTACCTGCTATAT TTCACAGAAACTCGACGTAAACTAGAAAACAGGCACGTCCAGTTGATTGCTATTTCCGGT GTCATTGGTACGGCGCTATTCGTGGCGATCGGAAAAGCTTTATACCGTGGAGGGCCCGCC TCTTTATTATTGGCATTTGCTCTTTGGTGTGTTCCAATACTTTGCATTACTGTGTCTACA GCGGAAATGGTCTGCTTTTTCCCTGTAAGTTCCCCCTTTTTGAGATTAGCAACGAAGTGC GTTGACGATTCATTGGCTGTCATGGCTAGCTGGAATTTCTGGTTTCTTGAATGCGTACAG ATCCCTTTCGAGATTGTTTCTGTTAATACAATTATACATTATTGGAGAGATGATTATTCA GCTGGTATTCCGCTCGCCGTTCAAGTAGTTTTGTATCTGCTTATTTCCATTTGTGCAGTC AAATATTACGGTGAAATGGAATTTTGGTTGGCTTCTTTCAAAATTATCCTTGCACTCGGC CTATTTACATTCACGTTCATTACCATGTTGGGTGGAAATCCTGAACATGATCGTTACGGG TTTCGTAATTATGGTGAAAGTCCATTCAAGAAATACTTTCCCGATGGCAATGATGTGGGG AAGTCTTCGGGCTACTTCCAGGGGTTTCTCGCTTGCTTGATTCAGGCATCGTTTACCATA GCTGGTGGCGAGTATATTTCTATGTTAGCGGGAGAGGTCAAACGACCAAGAAAAGTATTA CCCAAGGCGTTTAAGCAGGTGTTTGTGAGATTAACATTTTTGTTTTTAGGGAGTTGTCTG TGTGTTGGGATTGTTTGTTCGCCAAATGATCCTGACTTGACAGCAGCAATTAATGAAGCA AGGCCTGGCGCCGGGTCTTCACCTTATGTCATTGCAATGAATAATCTGAAAATTAGAATA TTACCTGACATTGTTAATATAGCTTTGATTACAGCCGCCTTTTCTGCTGGTAACGCTTAC ACTTATTGCTCATCCAGAACATTTTATGGTATGGCATTAGATGGCTACGCGCCAAAAATC TTCACTAGATGCAATAGGCATGGTGTGCCCATTTACTCTGTGGCCATATCTTTGGTATGG GCTTTAGTGAGCCTTTTGCAACTGAATTCTAATAGTGCGGTCGTATTGAATTGGTTAATT AACTTGATTACTGCCTCTCAATTGATTAATTTTGTCGTCCTTTGTATCGTCTATTTATTT TTCAGAAGGGCTTACCACGTCCAACAAGATTCGTTACCCAAGTTGCCATTCCGTTCGTGG GGTCAACCATACACTGCTATTATCGGCCTTGTTTCATGTTCCGCAATGATTTTAATACAG GGCTACACCGTTTTCTTTCCCAAATTATGGAACACACAAGATTTTTTGTTTTCGTATTTA ATGGTGTTTATCAACATCGGTATATATGTGGGCTACAAATTTATTTGGAAACGTGGTAAA GATCACTTCAAAAACCCACATGAAATTGACTTTTCTAAAGAGCTAACAGAAATTGAAAAC CATGAGATTGAAAGCTCCTTCGAAAAATTTCAATATTATAGCAAAGCATAA
Protein Properties
Pfam Domain Function
Protein Residues596
Protein Molecular Weight67261.29688
Protein Theoretical pI7.22
Signalling Regions
  • None
Transmembrane Regions
  • 95-115
  • 118-138
  • 166-186
  • 200-220
  • 228-248
  • 289-309
  • 327-347
  • 380-400
  • 428-448
  • 460-480
  • 506-526
  • 535-555
Protein Sequence>General amino acid permease AGP2 MTKERMTIDYENDGDFEYDKNKYKTITTRIKSIEPSEGWLEPSGSVGHINTIPEAGDVHV DEHEDRGSSIDDDSRTYLLYFTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPA SLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQ IPFEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALG LFTFTFITMLGGNPEHDRYGFRNYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTI AGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEA RPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKI FTRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLF FRRAYHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYL MVFINIGIYVGYKFIWKRGKDHFKNPHEIDFSKELTEIENHEIESSFEKFQYYSKA
References
External Links
ResourceLink
Saccharomyces Genome Database AGP2
Uniprot IDP38090
Uniprot NameAGP2_YEAST
GenBank Gene IDX75891
Genebank Protein ID496863
General Reference
  • Becam, A. M., Cullin, C., Grzybowska, E., Lacroute, F., Nasr, F., Ozier-Kalogeropoulos, O., Palucha, A., Slonimski, P. P., Zagulski, M., Herbert, C. J. (1994). "The sequence of 29.7 kb from the right arm of chromosome II reveals 13 complete open reading frames, of which ten correspond to new genes." Yeast 10 Suppl A:S1-11.8091856
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Nasr, F., Becam, A. M., Grzybowska, E., Zagulski, M., Slonimski, P. P., Herbert, C. J. (1994). "An analysis of the sequence of part of the right arm of chromosome II of S. cerevisiae reveals new genes encoding an amino-acid permease and a carboxypeptidase." Curr Genet 26:1-7.7954890
  • van Roermund, C. W., Hettema, E. H., van den Berg, M., Tabak, H. F., Wanders, R. J. (1999). "Molecular characterization of carnitine-dependent transport of acetyl-CoA from peroxisomes to mitochondria in Saccharomyces cerevisiae and identification of a plasma membrane carnitine transporter, Agp2p." EMBO J 18:5843-5852.10545096
  • Lee, J., Lee, B., Shin, D., Kwak, S. S., Bahk, J. D., Lim, C. O., Yun, D. J. (2002). "Carnitine uptake by AGP2 in yeast Saccharomyces cerevisiae is dependent on Hog1 MAP kinase pathway." Mol Cells 13:407-412.12132580
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258