You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRibose-phosphate pyrophosphokinase 4
Synonyms
  • Phosphoribosyl pyrophosphate synthase 4
Gene NamePRS4
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific Function5-phosphoribose 1-diphosphate synthase involved in nucleotide, histidine, and tryptophan biosynthesis. Active in heteromultimeric complexes with other 5-phosphoribose 1- diphosphate synthases (PRS2, PRS3, PRS4 and PRS5)
Cellular LocationCytoplasm
SMPDB Pathways
Histidine BiosynthesisPW002418 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose phosphate pathwayec00030 Map00030
Purine metabolismec00230 Map00230
SMPDB Reactions
D-Ribose 5-phosphate + Adenosine triphosphateAdenosine monophosphate + hydron + Phosphoribosyl pyrophosphate
KEGG Reactions
Adenosine triphosphate + alpha-D-ribose 5-phosphateAdenosine monophosphate + hydron + Phosphoribosyl pyrophosphate
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00119D-Ribose 5-phosphateShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
catalytic activity
transferase activity
magnesium ion binding
transferase activity, transferring phosphorus-containing groups
diphosphotransferase activity
ribose phosphate diphosphokinase activity
Process
biosynthetic process
nucleoside metabolic process
metabolic process
cellular biosynthetic process
nucleoside monophosphate metabolic process
nitrogen compound metabolic process
nucleoside monophosphate biosynthetic process
cellular nitrogen compound metabolic process
nucleotide biosynthetic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
ribonucleoside monophosphate biosynthetic process
nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBL068W
Gene Sequence>YBL068W PRS4 SGDID:S000000164, Chr II from 92414-93394, Verified ORF, "5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are ATGAATTCAGAGTCTCGAGAAGATATGGCTATAAATAGTATCAAATTGCTAGCGGGAAAC TCCCATCCTGATTTGGCTGAACAAATATCGAAAAAGTTAGGTATTCCACTTTCCAAAGTT GGTGTGTACCAGTATTCTAATAAAGAAACCTCTGTCACCATAGGTGAGAGCCTTCGCGAC GAAGATGTGTATATTATCCAAACTGGAATAGGTGAACAAGAAATTAATGATTTCTTGATG GAATTATTAATTTTAATTCATGCTTGCAAAATTGCATCTGCAAGAAAGATCACTACTGTA ATACCCAATTTTCCATATGCAAGACAAGACAAGAAAGATAAATCCCGGGCGCCCATTACC GCAAAGTTGGTTGCCAATTTATTGCAAACTGCTGGTGCTGATCATGTCATCACAATGGAT CTCCATGCCTCCCAAATTCAAGGGTTTTTCCATATCCCGGTTGACAACCTATATGCAGAA CCAAGTGTTTTAAATTATATTAGAACGAAAACAGATTTCGACAATGCTATTTTGGTGTCG CCTGATGCAGGTGGTGCTAAGAGAGTAGCTGCTTTGGCTGACAAGTTAGATTTAAATTTT GCTTTGATTCACAAAGAGAGGCAAAAAGCTAACGAGGTTTCAAAAATGGTGCTTGTTGGT GATGTTACCAATAAATCATGTTTATTAGTTGATGATATGGCGGATACTTGTGGTACGTTG GTAAAAGCTTGTGATACGTTGATGGAGCATGGTGCCAAAGAAGTTATAGCTATTGTTACA CACGGTATTTTCTCCGGTTCAGCAAGAGAAAAGCTAAGAAATAGTAGATTGTCTAGAATT GTTTGCACAAATACCGTTCCGGTAGATTTGGATTTACCTATTGCTGACCAGATCGATATT AGTCCCACGTTCGCTGAAGCTATAAGAAGACTACACAATGGTGAATCCGTGTCATATTTG TTCACCCATGCTCCAGTATAG
Protein Properties
Pfam Domain Function
Protein Residues327
Protein Molecular Weight35845.69922
Protein Theoretical pI6.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ribose-phosphate pyrophosphokinase 4 MNSESREDMAINSIKLLAGNSHPDLAEQISKKLGIPLSKVGVYQYSNKETSVTIGESLRD EDVYIIQTGIGEQEINDFLMELLILIHACQIASARKITTVIPNFPYARQDKKDKSRAPIT AKLVANLLQTAGADHVITMDLHASQIQGFFHIPVDNLYAEPSVLNYIRARKTDFDNAILV SPDAGGAKRVAALADKLDLNFALIHKERQKANEVSKMVLVGDVTNKSCLLVDDMADTCGT LVKACDTLMEHGAKEVIAIVTHGIFSGSAREKLRNSRLSRIVCTNTVPVDLDLPIADQID ISPTFAEAIRRLHNGESVSYLFTHAPV
References
External Links
ResourceLink
Saccharomyces Genome Database PRS4
Uniprot IDP38063
Uniprot NameKPR4_YEAST
General Reference
  • Hove-Jensen, B. (2004). "Heterooligomeric phosphoribosyl diphosphate synthase of Saccharomyces cerevisiae: combinatorial expression of the five PRS genes in Escherichia coli." J Biol Chem 279:40345-40350.15280369
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hernando, Y., Carter, A. T., Parr, A., Hove-Jensen, B., Schweizer, M. (1999). "Genetic analysis and enzyme activity suggest the existence of more than one minimal functional unit capable of synthesizing phosphoribosyl pyrophosphate in Saccharomyces cerevisiae." J Biol Chem 274:12480-12487.10212224
  • Kellis, M., Patterson, N., Endrizzi, M., Birren, B., Lander, E. S. (2003). "Sequencing and comparison of yeast species to identify genes and regulatory elements." Nature 423:241-254.12748633
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106