You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTyrosyl-tRNA synthetase, cytoplasmic
Synonyms
  • Tyrosyl--tRNA ligase
  • TyrRS
Gene NameTYS1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionCatalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction:tyrosine is first activated by ATP to form Tyr- AMP and then transferred to the acceptor end of tRNA(Tyr). The specificity determinants on tRNA(Tyr) are the base pair C1-G72, the discriminator residue A73, and the three anticodon bases G34, U35 and A36. Also involved in nuclear tRNA export
Cellular LocationCytoplasm. Nucleus.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Tyrosine + Adenosine triphosphate + tRNA(Tyr) → Adenosine monophosphate + Pyrophosphate + Tyr-tRNA(Tyr)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00364L-TyrosineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
purine nucleoside binding
catalytic activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
tyrosine-tRNA ligase activity
binding
nucleotide binding
nucleoside binding
Process
ncRNA metabolic process
tRNA metabolic process
tRNA aminoacylation
metabolic process
tRNA aminoacylation for protein translation
macromolecule metabolic process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
biosynthetic process
tyrosyl-tRNA aminoacylation
cellular macromolecule metabolic process
RNA metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR185C
Gene Sequence>1185 bp ATGTCCTCTGCTGCCACGGTTGACCCTAATGAGGCGTTCGGTCTCATTACCAAGAACTTG CAAGAAGTCTTGAACCCACAAATCATCAAAGATGTTCTCGAAGTACAAAAGAGACATTTG AAATTATACTGGGGTACCGCGCCCACTGGAAGACCTCATTGTGGTTATTTTGTTCCTATG ACCAAGCTTGCTGATTTCTTGAAAGCAGGTTGTGAAGTGACTGTTCTTTTAGCAGACTTG CACGCCTTTTTGGACAACATGAAGGCGCCATTGGAAGTGGTGAACTATAGGGCCAAATAC TATGAATTGACCATCAAAGCTATCTTGAGAAGCATCAATGTTCCAATTGAAAAGCTAAAA TTTGTTGTTGGCTCTTCTTACCAGCTAACTCCAGACTATACCATGGATATCTTTAGATTA TCCAACATTGTTTCACAAAACGATGCTAAAAGGGCAGGCGCTGATGTTGTCAAGCAAGTC GCCAATCCATTATTGAGTGGGCTTATCTATCCTTTAATGCAAGCGTTGGACGAACAATTC TTAGATGTTGATTGCCAATTTGGTGGTGTCGACCAGAGAAAAATTTTTGTCTTAGCGGAA GAAAATTTACCAAGTTTGGGCTACAAGAAAAGAGCACATTTAATGAACCCTATGGTTCCA GGTTTGGCTCAAGGTGGTAAAATGTCTGCCTCTGATCCGAATTCAAAAATCGACCTTTTG GAAGAACCAAAGCAAGTTAAGAAAAAGATCAATAGTGCATTTTGTAGCCCCGGTAACGTC GAAGAGAATGGTTTACTGTCATTTGTCCAATATGTCATTGCACCAATCCAAGAATTGAAG TTTGGTACAAATCACTTCGAATTCTTCATTGATAGACCAGAAAAGTTCGGTGGTCCAATT ACCTACAAATCCTTCGAAGAAATGAAATTGGCTTTTAAAGAAGAAAAATTGTCCCCACCT GATCTAAAAATTGGTGTTGCTGACGCTATCAACGAGCTATTGGAGCCAATCAGACAAGAA TTTGCCAACAACAAGGAATTTCAAGAGGCCTCCGAAAAGGGTTATCCAGTTGCCACACCA CAAAAGTCGAAAAAGGCTAAGAAACCAAAGAATAAGGGTACTAAGTACCCAGGCGCTACT AAGACCAACGAGATTGCCACGAAACTAGAGGAAACCAAATTGTAA
Protein Properties
Pfam Domain Function
Protein Residues394
Protein Molecular Weight44019.60156
Protein Theoretical pI8.74
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Tyrosyl-tRNA synthetase, cytoplasmic MSSAATVDPNEAFGLITKNLQEVLNPQIIKDVLEVQKRHLKLYWGTAPTGRPHCGYFVPM TKLADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYELTIKAILRSINVPIEKLK FVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVANPLLSGLIYPLMQALDEQF LDVDCQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPGLAQGGKMSASDPNSKIDLL EEPKQVKKKINSAFCSPGNVEENGLLSFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPI TYKSFEEMKLAFKEEKLSPPDLKIGVADAINELLEPIRQEFANNKEFQEASEKGYPVATP QKSKKAKKPKNKGTKYPGATKTNEIATKLEETKL
References
External Links
ResourceLink
Saccharomyces Genome Database TYS1
Uniprot IDP36421
Uniprot NameSYYC_YEAST
GenBank Gene IDL12221
Genebank Protein ID173120
General Reference
  • Chow, C. M., RajBhandary, U. L. (1993). "Saccharomyces cerevisiae cytoplasmic tyrosyl-tRNA synthetase gene. Isolation by complementation of a mutant Escherichia coli suppressor tRNA defective in aminoacylation and sequence analysis." J Biol Chem 268:12855-12863.8509419
  • Guan, M. X. (1997). "Cytoplasmic tyrosyl-tRNA synthetase rescues the defect in mitochondrial genome maintenance caused by the nuclear mutation mgm104-1 in the yeast Saccharomyces cerevisiae." Mol Gen Genet 255:525-532.9294037
  • Arroyo, J., Garcia-Gonzalez, M., Garcia-Saez, M. I., Sanchez, M., Nombela, C. (1997). "DNA sequence analysis of a 23,002 bp DNA fragment of the right arm of Saccharomyces cerevisiae chromosome VII." Yeast 13:357-363.9133739
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Henry, N. L., Campbell, A. M., Feaver, W. J., Poon, D., Weil, P. A., Kornberg, R. D. (1994). "TFIIF-TAF-RNA polymerase II connection." Genes Dev 8:2868-2878.7995524
  • Faulhammer, H. G., Cramer, F. (1977). "Tyroslyl-tRNA synthetase from baker's yeast. Rapid isolation by affinity elution, molecular weight of the enzyme, and determination of essential sulfhydryl groups." Eur J Biochem 75:561-570.328277
  • Bare, L. A., Uhlenbeck, O. C. (1986). "Specific substitution into the anticodon loop of yeast tyrosine transfer RNA." Biochemistry 25:5825-5830.3535890
  • Sarkar, S., Azad, A. K., Hopper, A. K. (1999). "Nuclear tRNA aminoacylation and its role in nuclear export of endogenous tRNAs in Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 96:14366-14371.10588711
  • Fechter, P., Rudinger-Thirion, J., Theobald-Dietrich, A., Giege, R. (2000). "Identity of tRNA for yeast tyrosyl-tRNA synthetase: tyrosylation is more sensitive to identity nucleotides than to structural features." Biochemistry 39:1725-1733.10677221
  • Dagkessamanskaia, A., Martin-Yken, H., Basmaji, F., Briza, P., Francois, J. (2001). "Interaction of Knr4 protein, a protein involved in cell wall synthesis, with tyrosine tRNA synthetase encoded by TYS1 in Saccharomyces cerevisiae." FEMS Microbiol Lett 200:53-58.11410349
  • Ohno, S., Yokogawa, T., Nishikawa, K. (2001). "Changing the amino acid specificity of yeast tyrosyl-tRNA synthetase by genetic engineering." J Biochem 130:417-423.11530018
  • Azad, A. K., Stanford, D. R., Sarkar, S., Hopper, A. K. (2001). "Role of nuclear pools of aminoacyl-tRNA synthetases in tRNA nuclear export." Mol Biol Cell 12:1381-1392.11359929
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956