You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCarboxylic acid transporter protein homolog
SynonymsNot Available
Gene NameJEN1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in carbohydrate transmembrane transporter activity
Specific FunctionEssential to lactate transport
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00175Pyruvic acidShow
YMDB00247L-Lactic acidShow
YMDB00287D-Lactic acidShow
YMDB00862hydronShow
GO Classification
Component
intrinsic to membrane
integral to membrane
cell part
membrane part
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
carbohydrate transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 11
LocusYKL217W
Gene Sequence>1851 bp ATGTCGTCGTCAATTACAGATGAGAAAATATCTGGTGAACAGCAACAACCTGCTGGCAGA AAACTATACTATAACACAAGTACATTTGCAGAGCCTCCTCTAGTGGACGGAGAAGGTAAC CCTATAAATTATGAGCCGGAAGTTTACAACCCGGATCACGAAAAGCTATACCATAACCCA TCACTGCCTGCACAATCAATTCAGGATACAAGAGATGATGAATTGCTGGAAAGAGTTTAT AGCCAGGATCAAGGTGTAGAGTATGAGGAAGATGAAGAGGATAAGCCAAACCTAAGCGCT GCGTCCATTAAAAGTTATGCTTTAACGAGATTTACGTCCTTACTGCACATCCACGAGTTT TCTTGGGAGAATGTCAATCCCATACCCGAACTGCGCAAAATGACATGGCAGAATTGGAAC TATTTTTTTATGGGTTATTTTGCGTGGTTGTCTGCGGCTTGGGCCTTCTTTTGCGTTTCA GTATCAGTCGCTCCATTGGCTGAACTATATGACAGACCAACCAAGGACATCACCTGGGGG TTGGGATTGGTGTTATTTGTTCGTTCAGCAGGTGCTGTCATATTTGGTTTATGGACAGAT AAGTCTTCCAGAAAGTGGCCGTACATTACATGTTTGTTCTTATTTGTCATTGCACAACTC TGTACTCCATGGTGTGACACATACGAGAAATTTCTGGGCGTAAGGTGGATAACCGGTATT GCTATGGGAGGAATTTACGGATGTGCTTCTGCAACAGCGATTGAAGATGCACCTGTGAAA GCACGTTCGTTCCTATCAGGTCTATTTTTTTCTGCTTACGCTATGGGGTTCATATTTGCT ATCATTTTTTACAGAGCCTTTGGCTACTTTAGGGATGATGGCTGGAAAATATTGTTTTGG TTTAGTATTTTTCTACCAATTCTACTAATTTTCTGGAGATTGTTATGGCCTGAAACGAAA TACTTCACCAAGGTTTTGAAAGCCCGTAAATTAATATTGAGTGACGCAGTGAAAGCTAAT GGTGGCGAGCCTCTACCAAAAGCCAACTTTAAACAAAAGATGGTATCCATGAAGAGAACA GTTCAAAAGTACTGGTTGTTGTTCGCATATTTGGTTGTTTTATTGGTGGGTCCAAATTAC TTGACTCATGCTTCTCAAGACTTGTTGCCAACCATGCTGCGTGCCCAATTAGGCCTATCC AAGGATGCTGTCACTGTCATTGTAGTGGTTACCAACATCGGTGCTATTTGTGGGGGTATG ATATTTGGACAGTTCATGGAAGTTACTGGAAGAAGATTAGGCCTATTGATTGCATGCACA ATGGGTGGTTGCTTCACCTACCCTGCATTTATGTTGAGAAGCGAAAAGGCTATATTAGGT GCCGGTTTCATGTTATATTTTTGTGTCTTTGGTGTCTGGGGTATCCTGCCCATTCACCTT GCAGAGTTGGCCCCTGCTGATGCAAGGGCTTTGGTTGCCGGTTTATCTTACCAGCTAGGT AATCTAGCTTCTGCAGCGGCTTCCACGATTGAGACACAGTTAGCTGATAGATACCCATTA GAAAGAGATGCCTCTGGTGCTGTGATTAAAGAAGATTATGCCAAAGTTATGGCTATCTTG ACTGGTTCTGTTTTCATCTTCACATTTGCTTGTGTTTTTGTTGGCCATGAGAAATTCCAT CGTGATTTGTCCTCTCCTGTTATGAAGAAATATATAAACCAAGTGGAAGAATACGAAGCC GATGGTCTTTCGATTAGTGACATTGTTGAACAAAAGACGGAATGTGCTTCAGTGAAGATG ATTGATTCGAACGTCTCAAAGACATATGAGGAGCATATTGAGACCGTTTAA
Protein Properties
Pfam Domain Function
Protein Residues616
Protein Molecular Weight69375.60156
Protein Theoretical pI5.72
Signalling Regions
  • None
Transmembrane Regions
  • 141-161
  • 177-197
  • 206-226
  • 231-251
  • 264-284
  • 297-317
  • 364-384
  • 403-423
  • 433-453
  • 458-478
  • 490-510
  • 536-556
Protein Sequence>Carboxylic acid transporter protein homolog MSSSITDEKISGEQQQPAGRKLYYNTSTFAEPPLVDGEGNPINYEPEVYNPDHEKLYHNP SLPAQSIQDTRDDELLERVYSQDQGVEYEEDEEDKPNLSAASIKSYALTRFTSLLHIHEF SWENVNPIPELRKMTWQNWNYFFMGYFAWLSAAWAFFCVSVSVAPLAELYDRPTKDITWG LGLVLFVRSAGAVIFGLWTDKSSRKWPYITCLFLFVIAQLCTPWCDTYEKFLGVRWITGI AMGGIYGCASATAIEDAPVKARSFLSGLFFSAYAMGFIFAIIFYRAFGYFRDDGWKILFW FSIFLPILLIFWRLLWPETKYFTKVLKARKLILSDAVKANGGEPLPKANFKQKMVSMKRT VQKYWLLFAYLVVLLVGPNYLTHASQDLLPTMLRAQLGLSKDAVTVIVVVTNIGAICGGM IFGQFMEVTGRRLGLLIACTMGGCFTYPAFMLRSEKAILGAGFMLYFCVFGVWGILPIHL AELAPADARALVAGLSYQLGNLASAAASTIETQLADRYPLERDASGAVIKEDYAKVMAIL TGSVFIFTFACVFVGHEKFHRDLSSPVMKKYINQVEEYEADGLSISDIVEQKTECASVKM IDSNVSKTYEEHIETV
References
External Links
ResourceLink
Saccharomyces Genome Database JEN1
Uniprot IDP36035
Uniprot NameJEN1_YEAST
GenBank Gene IDU24155
Genebank Protein ID780802
General Reference
  • Tzermia, M., Horaitis, O., Alexandraki, D. (1994). "The complete sequencing of a 24.6 kb segment of yeast chromosome XI identified the known loci URA1, SAC1 and TRP3, and revealed 6 new open reading frames including homologues to the threonine dehydratases, membrane transporters, hydantoinases and the phospholipase A2-activating protein." Yeast 10:663-679.7941750
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666