You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSerine/threonine-protein kinase TOR1
Synonyms
  • Dominant rapamycin resistance protein 1
  • Phosphatidylinositol kinase homolog TOR1
  • Target of rapamycin kinase 1
Gene NameTOR1
Enzyme ClassNot Available
Biological Properties
General Functiontranslational initiation
Specific FunctionPhosphatidylinositol 3-kinase homolog, component of TORC1, which regulates multiple cellular processes to control cell growth in response to environmental signals. Nutrient limitation and environmental stress signals cause inactivation of TORC1. Active TORC1 positively controls ribosome biogenesis via control of rRNA, ribosomal protein and tRNA gene expression, and rRNA processing. TORC1 positively controls protein biosynthesis by regulation of mRNA stability, translation initiation factor activity, and high-affinity amino acid permeases that serve to provide amino acids for use by the translation machinery. TORC1 also promotes growth by sequestering a number of nutrient and general stress-responsive transcription factors in the cytoplasm. TORC1 negatively controls macroautophagy, a process to recycle surplus cytoplasmic mass under nutrient starvation conditions. TORC1 controls many of these processes via TIP41-TAP42-mediated inhibition of the type 2A-related phosphatases PP2A and SIT4 (PubMed:10198052, PubMed:10329624, PubMed:10604478, PubMed:10995454, PubMed:11741537, PubMed:15620355, PubMed:7606777, PubMed:8741837, PubMed:9539725, PubMed:9843498). In nutrient rich conditions, responsible for the phosphorylation of AGC S6 kinase (S6K) YPK3, activating YPK3 kinase activity and promoting phosphorylation of ribosomal protein S6 (PubMed:25767889). Phosphorylates kinase SCH9 at 6 amino acids in the C-terminus, activating SCH9 kinase activity to properly regulate ribosome biogenesis, translation initiation, and entry into stationary phase (PubMed:17560372).
Cellular LocationNot Available
SMPDB Pathways
TOR signalling pathway: Rapamycin based repressionPW002514 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
Type 2A phosphatase activator TIP41 + phosphate → Phosphorylated TIP41
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00907phosphateShow
GO Classification
Function
nucleus
cellular response to DNA damage stimulus
cytoplasm
meiotic nuclear division
protein serine/threonine kinase activity
mitochondria-nucleus signaling pathway
peptidyl-serine phosphorylation
negative regulation of autophagy
endosome membrane
regulation of cell growth
plasma membrane
regulation of sphingolipid biosynthetic process
fungal-type vacuole membrane
ribosome biogenesis
DNA repair
transcription of nuclear large rRNA transcript from RNA polymerase I promoter
fungal-type cell wall organization
translational initiation
TOR signaling
protein kinase activity
regulation of cell cycle
extrinsic component of cytoplasmic side of plasma membrane
Golgi membrane
TORC1 complex
ATP binding
macromolecular complex binding
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>7413 bp ATGGAACCGCATGAGGAGCAGATTTGGAAGAGTAAACTTTTGAAAGCGGCTAACAACGAT ATGGACATGGATAGAAATGTGCCGTTGGCACCGAATCTGAATGTGAATATGAACATGAAA ATGAATGCGAGCAGGAACGGGGATGAATTCGGTCTGACTTCTAGTAGGTTTGATGGAGTG GTGATTGGCAGTAATGGGGATGTAAATTTTAAGCCCATTTTGGAGAAAATTTTCCGCGAA TTAACCAGTGATTACAAGGAGGAACGAAAATTGGCCAGTATTTCATTATTTGATCTACTA GTATCCTTGGAACATGAATTGTCGATAGAAGAGTTCCAAGCAGTTTCAAATGACATAAAC AATAAGATTTTGGAGCTGGTCCATACAAAAAAAACGAGCACTAGGGTAGGGGCTGTTCTA TCCATAGACACTTTGATTTCATTCTACGCATATACTGAAAGGTTGCCTAACGAAACTTCA CGACTGGCTGGTTACCTTCGAGGGCTAATACCTTCTAATGATGTAGAGGTCATGAGACTC GCTGCAAAGACTCTGGGCAAGTTAGCCGTTCCAGGAGGTACATATACCTCTGATTTCGTG GAATTTGAGATAAAGTCTTGCTTAGAATGGCTTACTGCCTCCACGGAAAAGAATTCATTC TCGAGTTCGAAGCCAGACCATGCTAAACATGCTGCGCTTCTGATTATAACAGCGTTGGCA GAGAATTGTCCTTATTTACTCTACCAATACTTGAATTCCATACTAGATAACATTTGGAGA GCACTAAGAGACCCACATTTGGTGATCAGAATTGATGCGTCCATTACATTGGCCAAATGT CTTTCCACCCTACGAAATAGGGATCCTCAGTTAACTAGCCAGTGGGTGCAGAGATTGGCT ACAAGTTGTGAATACGGATTTCAAGTAAACACATTAGAATGCATCCATGCAAGTTTGTTG GTTTATAAGGAAATCTTGTTTTTGAAGGATCCCTTTTTGAATCAAGTGTTCGACCAAATG TGTCTAAATTGCATAGCTTATGAAAATCATAAAGCGAAAATGATTAGAGAAAAGATTTAC CAGATTGTTCCCCTATTAGCATCGTTCAATCCTCAATTATTTGCTGGCAAATATTTGCAC CAAATTATGGACAACTATTTAGAGATTTTAACCAATGCTCCAGCAAATAAAATACCACAT CTCAAAGATGACAAACCACAGATTTTAATATCGATTGGTGATATTGCATATGAAGTCGGG CCCGATATCGCACCTTATGTGAAACAAATTCTTGATTATATTGAACATGATTTACAGACG AAATTCAAATTCAGAAAGAAATTTGAAAATGAAATTTTCTACTGCATCGGAAGATTGGCA GTTCCCTTGGGCCCCGTTCTAGGTAAATTATTAAACAGAAATATACTGGACCTGATGTTC AAATGCCCTCTTTCCGACTATATGCAGGAAACGTTTCAAATTCTGACTGAGAGAATACCA TCACTAGGCCCCAAAATAAATGACGAGTTGCTTAACCTAGTCTGTTCAACCTTATCTGGA ACACCATTTATCCAGCCAGGGTCACCAATGGAGATACCATCGTTTTCGAGAGAAAGAGCA AGAGAATGGAGAAATAAAAACATCCTACAGAAAACTGGTGAAAGTAACGATGATAATAAT GATATAAAAATCATTATACAAGCTTTTAGAATGTTAAAAAATATCAAAAGCAGATTTTCG TTGGTGGAATTCGTGAGAATTGTTGCACTTTCTTACATTGAGCATACAGATCCCAGAGTA AGGAAACTAGCTGCGTTGACATCTTGTGAAATTTACGTCAAGGATAACATCTGCAAACAA ACATCACTACACTCTCTGAACACTGTATCTGAAGTGTTATCAAAGCTTCTAGCCATTACG ATTGCGGACCCTTTACAAGATATCCGTTTAGAAGTTTTAAAGAATCTTAATCCATGTTTC GATCCCCAGTTGGCACAACCAGATAATTTGAGACTCTTGTTTACTGCACTGCACGATGAG TCGTTCAATATTCAGTCAGTAGCAATGGAGCTTGTCGGTAGGTTGTCTTCCGTAAACCCT GCATACGTCATCCCATCGATAAGAAAAATACTACTGGAACTGCTAACAAAATTAAAATTC TCAACTTCTTCTCGAGAAAAGGAAGAAACTGCCAGTTTGTTATGTACTCTTATCAGGTCG AGTAAAGATGTTGCGAAACCTTATATCGAACCTCTTTTAAATGTTCTTTTACCAAAATTC CAAGATACCTCTTCAACGGTTGCATCAACTGCACTGAGAACTATAGGTGAGCTATCTGTT GTAGGGGGCGAAGATATGAAGATATATCTTAAGGATTTGTTTCCTTTAATTATCAAAACA TTTCAGGATCAATCAAACTCTTTCAAGAGAGAAGCTGCACTTAAGGCCCTTGGTCAACTT GCAGCCTCATCTGGTTACGTGATAGATCCTTTACTCGACTATCCCGAATTATTGGGTATA TTGGTGAATATATTGAAGACAGAAAACTCTCAAAATATTAGGAGACAAACAGTCACTTTG ATAGGTATACTGGGAGCTATCGACCCATATCGCCAAAAAGAACGTGAGGTTACCTCTACT ACCGATATATCTACAGAACAGAACGCCCCGCCTATCGACATTGCTCTTCTCATGCAGGGC ATGTCTCCTTCGAATGATGAGTATTATACCACTGTTGTCATTCACTGCCTGCTAAAAATC CTAAAAGATCCATCCCTATCATCTTACCACACTGCCGTGATCCAAGCGATTATGCATATT TTTCAAACCCTTGGTCTAAAATGTGTTTCATTCTTGGACCAGATCATCCCAACTATTTTG GACGTAATGCGTACATGCTCTCAGTCACTATTAGAATTTTACTTCCAACAGCTTTGCTCT TTGATTATTATCGTAAGGCAACACATAAGACCTCATGTCGATTCTATATTCCAGGCTATC AAAGATTTTTCTTCGGTTGCTAAGCTACAAATAACGCTTGTAAGTGTTATTGAAGCAATA TCAAAGGCTCTGGAGGGTGAATTCAAAAGATTGGTCCCTCTTACTCTGACCTTGTTCCTT GTAATTTTGGAGAATGACAAGTCTAGTGACAAGGTCCTCTCCAGAAGGGTATTGAGACTG TTAGAATCGTTTGGTCCTAACTTAGAAGGTTATTCGCATTTGATTACACCCAAGATAGTT CAAATGGCAGAATTCACCAGCGGGAACCTACAAAGGTCTGCAATAATTACTATTGGCAAA CTGGCCAAGGATGTTGACCTTTTTGAGATGTCCTCAAGAATTGTTCACTCTTTACTTAGG GTACTAAGTTCAACAACGAGTGACGAACTCTCAAAAGTCATTATGAATACTTTAAGTCTA CTGCTAATACAAATGGGCACATCCTTTGCTATCTTCATCCCTGTCATTAATGAAGTTTTA ATGAAGAAACATATTCAACACACAATATATGATGACTTGACAAACAGAATATTAAACAAT GATGTTTTACCCACAAAAATTCTTGAAGCAAATACAACGGATTATAAGCCCGCGGAACAA ATGGAGGCAGCAGATGCTGGGGTCGCAAAATTACCTATAAACCAATCAGTTTTGAAAAGT GCATGGAATTCTAGCCAACAAAGAACTAAAGAAGATTGGCAGGAATGGAGCAAACGTCTA TCCATTCAATTATTAAAAGAGTCACCCTCCCATGCTCTAAGAGCTTGTTCAAATCTTGCA AGCATGTATTATCCACTAGCCAAAGAACTTTTTAATACCGCATTCGCATGTGTTTGGACC GAACTTTATAGCCAATATCAAGAAGATTTAATTGGGTCATTATGTATAGCCTTATCTTCT CCCTTAAATCCACCAGAAATACATCAAACATTGTTAAACCTGGTAGAATTTATGGAACAC GATGACAAGGCATTACCAATACCAACTCAAAGCCTGGGCGAGTATGCTGAAAGATGTCAC GCCTATGCCAAAGCGCTACATTATAAAGAGATTAAATTTATTAAAGAGCCTGAGAACTCA ACTATTGAATCATTGATCAGCATTAACAACCAGCTGAATCAAACGGATGCTGCAATTGGT ATATTAAAGCATGCCCAACAACATCATTCACTTCAATTAAAGGAGACATGGTTTGAAAAA TTAGAGCGTTGGGAAGATGCACTACATGCTTATAATGAACGTGAAAAGGCAGGTGATACT TCCGTGAGCGTTACACTCGGTAAGATGAGATCCCTTCATGCCCTTGGCGAATGGGAACAG TTGTCGCAATTGGCAGCTAGAAAGTGGAAAGTTTCGAAGCTACAAACTAAGAAGCTAATA GCTCCCTTGGCAGCTGGTGCTGCGTGGGGGTTGGGAGAGTGGGATATGCTTGAGCAATAT ATCAGCGTTATGAAACCTAAATCTCCAGATAAGGAATTTTTTGATGCAATTTTATACTTG CACAAGAATGATTACGACAATGCTAGTAAGCATATATTAAACGCCAGAGATTTGCTTGTG ACTGAAATTTCCGCGTTGATCAATGAAAGTTATAATAGAGCATATAGCGTTATTGTTAGA ACTCAAATAATAACAGAGTTTGAGGAAATCATCAAGTATAAACAATTGCCACCTAATTCC GAGAAAAAACTTCACTATCAAAATCTTTGGACAAAAAGACTGCTGGGCTGCCAAAAAAAT GTCGATTTATGGCAAAGAGTGCTTAGAGTAAGATCATTGGTAATAAAGCCCAAGCAAGAC CTGCAAATATGGATAAAATTTGCAAATTTGTGCAGAAAATCTGGTAGAATGAGGCTAGCA AATAAGGCATTGAATATGCTACTAGAAGGAGGCAACGATCCTAGTTTACCAAATACGTTC AAAGCTCCTCCCCCAGTTGTTTACGCGCAACTAAAATATATTTGGGCTACAGGAGCTTAT AAAGAAGCATTAAACCACTTGATAGGATTTACATCCAGGTTAGCGCATGATCTTGGTTTG GATCCGAATAATATGATCGCGCAAAGTGTCAAACTCTCAAGTGCAAGTACTGCTCCGTAT GTTGAGGAATACACAAAATTATTAGCTCGATGTTTTTTAAAGCAAGGTGAGTGGAGAATA GCAACACAACCGAACTGGAGAAACACAAATCCGGATGCAATTCTTGGTTCTTATCTATTG GCTACACATTTCGATAAAAATTGGTACAAGGCATGGCATAATTGGGCCTTAGCTAATTTT GAAGTAATATCCATGGTTCAGGAAGAGACTAAGCTCAACGGAGGTAAGAATGATGATGAT GATGACACGGCAGTTAATAATGATAATGTGCGGATTGACGGTAGTATCCTAGGAAGTGGT TCTTTGACTATTAATGGCAACAGATACCCGCTAGAGCTTATTCAAAGACATGTTGTTCCA GCGATCAAGGGCTTTTTTCATTCAATATCTCTATTAGAAACAAGTTGTTTGCAAGACACG TTGAGGTTATTGACTCTTTTATTTAACTTTGGTGGTATTAAAGAAGTCTCACAAGCCATG TATGAAGGCTTCAATTTGATGAAAATAGAGAACTGGCTTGAAGTCTTACCACAGTTGATC TCTCGTATACATCAGCCAGATCCTACGGTGAGTAATTCCCTTTTGTCGTTGCTTTCTGAT TTAGGGAAAGCTCATCCACAAGCTCTCGTGTATCCTTTAACTGTCGCGATCAAGTCTGAA TCTGTTTCAAGACAAAAAGCGGCTCTTTCAATAATAGAGAAAATTAGGATTCATAGTCCA GTCCTGGTAAACCAGGCAGAATTAGTTAGTCACGAGTTGATCAGAGTAGCCGTTCTATGG CACGAATTATGGTATGAAGGACTGGAAGATGCGAGCCGCCAATTTTTCGTTGAACATAAC ATAGAAAAAATGTTTTCTACTTTAGAACCTTTACATAAACACTTAGGCAATGAGCCTCAA ACGTTAAGTGAGGTATCGTTTCAGAAATCATTTGGTAGAGATTTGAACGATGCCTACGAA TGGTTGAATAACTACAAAAAGTCAAAAGACATCAATAATTTGAACCAAGCTTGGGATATT TATTATAACGTCTTCAGAAAAATAACACGTCAAATACCACAGTTACAAACCTTAGACTTA CAGCATGTTTCTCCCCAGCTTCTGGCTACTCATGATCTCGAATTGGCTGTTCCTGGGACA TATTTCCCAGGAAAACCTACCATTAGAATAGCGAAGTTTGAGCCATTATTTTCTGTGATC TCTTCGAAGCAAAGGCCAAGAAAATTCTCCATCAAGGGTAGCGACGGTAAAGATTATAAA TACGTTTTAAAGGGACATGAAGATATAAGACAAGATAGCCTTGTTATGCAATTATTTGGT CTAGTTAACACTTTGTTGAAGAATGATTCAGAGTGTTTCAAGAGACATTTGGATATCCAA CAATACCCGGCTATTCCATTGTCGCCTAAATCTGGTTTACTAGGATGGGTACCAAATAGT GACACATTCCACGTTTTGATCAGAGAACACCGTGATGCCAAAAAAATTCCGTTGAACATT GAACATTGGGTTATGTTACAAATGGCCCCCGATTATGAGAATTTGACTCTTTTACAAAAA ATTGAAGTATTCACGTACGCTTTAGATAATACAAAAGGCCAAGACCTTTATAAAATATTA TGGTTAAAGAGTAGGTCGTCAGAGACATGGCTAGAACGTAGAACAACTTATACGAGATCT TTAGCAGTTATGTCCATGACTGGTTATATTCTGGGACTAGGTGATCGCCATCCAAGCAAC CTGATGCTAGATAGAATCACCGGTAAAGTTATCCACATTGATTTCGGCGATTGTTTTGAA GCTGCCATCTTAAGAGAAAAGTATCCAGAAAAAGTGCCATTTAGACTAACTAGGATGTTA ACATACGCAATGGAAGTTAGTGGAATTGAAGGCAGTTTCCGAATTACTTGTGAAAATGTC ATGAGAGTCTTAAGAGATAATAAAGAATCATTAATGGCGATCTTGGAAGCTTTTGCGCTT GATCCTTTGATCCATTGGGGATTTGATTTACCGCCACAAAAACTTACTGAGCAAACTGGA ATTCCTTTGCCGTTGATTAATCCTAGTGAATTATTAAGGAAGGGGGCAATTACTGTCGAA GAAGCGGCAAATATGGAAGCAGAACAACAAAATGAGACCAAAAACGCCAGAGCAATGCTT GTTTTGAGACGTATTACAGATAAATTAACGGGCAATGATATCAAGAGGTTCAATGAATTA GACGTCCCTGAGCAGGTTGATAAACTGATCCAACAAGCCACTTCTATTGAAAGGTTATGT CAACATTATATTGGATGGTGCCCATTCTGGTGA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues2470
Protein Molecular Weight281136.755
Protein Theoretical pINot Available
PDB Fileshow
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Serine/threonine-protein kinase TOR1 MEPHEEQIWKSKLLKAANNDMDMDRNVPLAPNLNVNMNMKMNASRNGDEFGLTSSRFDGV VIGSNGDVNFKPILEKIFRELTSDYKEERKLASISLFDLLVSLEHELSIEEFQAVSNDIN NKILELVHTKKTSTRVGAVLSIDTLISFYAYTERLPNETSRLAGYLRGLIPSNDVEVMRL AAKTLGKLAVPGGTYTSDFVEFEIKSCLEWLTASTEKNSFSSSKPDHAKHAALLIITALA ENCPYLLYQYLNSILDNIWRALRDPHLVIRIDASITLAKCLSTLRNRDPQLTSQWVQRLA TSCEYGFQVNTLECIHASLLVYKEILFLKDPFLNQVFDQMCLNCIAYENHKAKMIREKIY QIVPLLASFNPQLFAGKYLHQIMDNYLEILTNAPANKIPHLKDDKPQILISIGDIAYEVG PDIAPYVKQILDYIEHDLQTKFKFRKKFENEIFYCIGRLAVPLGPVLGKLLNRNILDLMF KCPLSDYMQETFQILTERIPSLGPKINDELLNLVCSTLSGTPFIQPGSPMEIPSFSRERA REWRNKNILQKTGESNDDNNDIKIIIQAFRMLKNIKSRFSLVEFVRIVALSYIEHTDPRV RKLAALTSCEIYVKDNICKQTSLHSLNTVSEVLSKLLAITIADPLQDIRLEVLKNLNPCF DPQLAQPDNLRLLFTALHDESFNIQSVAMELVGRLSSVNPAYVIPSIRKILLELLTKLKF STSSREKEETASLLCTLIRSSKDVAKPYIEPLLNVLLPKFQDTSSTVASTALRTIGELSV VGGEDMKIYLKDLFPLIIKTFQDQSNSFKREAALKALGQLAASSGYVIDPLLDYPELLGI LVNILKTENSQNIRRQTVTLIGILGAIDPYRQKEREVTSTTDISTEQNAPPIDIALLMQG MSPSNDEYYTTVVIHCLLKILKDPSLSSYHTAVIQAIMHIFQTLGLKCVSFLDQIIPTIL DVMRTCSQSLLEFYFQQLCSLIIIVRQHIRPHVDSIFQAIKDFSSVAKLQITLVSVIEAI SKALEGEFKRLVPLTLTLFLVILENDKSSDKVLSRRVLRLLESFGPNLEGYSHLITPKIV QMAEFTSGNLQRSAIITIGKLAKDVDLFEMSSRIVHSLLRVLSSTTSDELSKVIMNTLSL LLIQMGTSFAIFIPVINEVLMKKHIQHTIYDDLTNRILNNDVLPTKILEANTTDYKPAEQ MEAADAGVAKLPINQSVLKSAWNSSQQRTKEDWQEWSKRLSIQLLKESPSHALRACSNLA SMYYPLAKELFNTAFACVWTELYSQYQEDLIGSLCIALSSPLNPPEIHQTLLNLVEFMEH DDKALPIPTQSLGEYAERCHAYAKALHYKEIKFIKEPENSTIESLISINNQLNQTDAAIG ILKHAQQHHSLQLKETWFEKLERWEDALHAYNEREKAGDTSVSVTLGKMRSLHALGEWEQ LSQLAARKWKVSKLQTKKLIAPLAAGAAWGLGEWDMLEQYISVMKPKSPDKEFFDAILYL HKNDYDNASKHILNARDLLVTEISALINESYNRAYSVIVRTQIITEFEEIIKYKQLPPNS EKKLHYQNLWTKRLLGCQKNVDLWQRVLRVRSLVIKPKQDLQIWIKFANLCRKSGRMRLA NKALNMLLEGGNDPSLPNTFKAPPPVVYAQLKYIWATGAYKEALNHLIGFTSRLAHDLGL DPNNMIAQSVKLSSASTAPYVEEYTKLLARCFLKQGEWRIATQPNWRNTNPDAILGSYLL ATHFDKNWYKAWHNWALANFEVISMVQEETKLNGGKNDDDDDTAVNNDNVRIDGSILGSG SLTINGNRYPLELIQRHVVPAIKGFFHSISLLETSCLQDTLRLLTLLFNFGGIKEVSQAM YEGFNLMKIENWLEVLPQLISRIHQPDPTVSNSLLSLLSDLGKAHPQALVYPLTVAIKSE SVSRQKAALSIIEKIRIHSPVLVNQAELVSHELIRVAVLWHELWYEGLEDASRQFFVEHN IEKMFSTLEPLHKHLGNEPQTLSEVSFQKSFGRDLNDAYEWLNNYKKSKDINNLNQAWDI YYNVFRKITRQIPQLQTLDLQHVSPQLLATHDLELAVPGTYFPGKPTIRIAKFEPLFSVI SSKQRPRKFSIKGSDGKDYKYVLKGHEDIRQDSLVMQLFGLVNTLLKNDSECFKRHLDIQ QYPAIPLSPKSGLLGWVPNSDTFHVLIREHRDAKKIPLNIEHWVMLQMAPDYENLTLLQK IEVFTYALDNTKGQDLYKILWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSN LMLDRITGKVIHIDFGDCFEAAILREKYPEKVPFRLTRMLTYAMEVSGIEGSFRITCENV MRVLRDNKESLMAILEAFALDPLIHWGFDLPPQKLTEQTGIPLPLINPSELLRKGAITVE EAANMEAEQQNETKNARAMLVLRRITDKLTGNDIKRFNELDVPEQVDKLIQQATSIERLC QHYIGWCPFW
References
External Links
ResourceLink
Saccharomyces Genome Database TOR1
Uniprot IDP35169
Uniprot NameTOR1
PDB ID
1W1N
General ReferenceNot Available