You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBeta-glucan synthesis-associated protein KRE6
Synonyms
  • Killer toxin-resistance protein 6
Gene NameKRE6
Enzyme ClassNot Available
Biological Properties
General FunctionCarbohydrate transport and metabolism
Specific FunctionInvolved in the synthesis of (1->6)- and (1->3)-beta-D- glucan polymers of the yeast cell wall in vivo. It is required for full activity of beta-glucan synthase in vitro. May be involved in the maturation and transport of cell wall proteins (CWP) to the cell wall. May act as a transglucosidase and contribute to the construction of a protein-bound glucan-structure that acts as an acceptor site for the addition of (1->6)-beta-D-glucan at the cell surface
Cellular LocationGolgi apparatus membrane; Single-pass type II membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Uridine diphosphate glucoseUridine 5'-diphosphate + hydron + (1->6)-beta-D-glucan
Metabolites
YMDB IDNameView
YMDB00307Uridine 5'-diphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00862hydronShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 16
LocusYPR159W
Gene Sequence>2163 bp ATGCCTTTGAGAAATCTAACTGAAACGCACAACTTTAGTAGCACAAACCTGGACACAGAT GGTACAGGCGACGATCATGATGGTGCTCCTCTTTCCTCATCTCCTTCTTTTGGACAACAA AATGACAATAGCACCAACGATAATGCTGGTCTCACAAACCCTTTTATGGGGAGTGACGAA GAATCCAATGCGCGGGATGGAGAATCTCTGTCTTCTTCTGTTCATTATCAGCCACAGGGG AGTGACTCTTCACTACTTCATGACAATTCTCGTCTAGATCTAAGTCAAAATAAAGGTGTA TCTGATTACAAAGGTTACTATTCCAGGAACAATAGTAGAGCTGTGAGTACGGCTAATGAT AACTCATTTCTTCAGCCACCACATAGAGCTATAGCCTCTTCTCCTTCTTTGAATTCTAAT TTATCGAAGAATGATATTCTCTCACCGCCAGAATTTGATAGATATCCCTTAGTGGGTTCC AGAGTCACTTCTATGACTCAACTGAACCATCATGGTCGCTCGCCAACATCATCTCCAGGA AACGAGTCGTCCGCCTCATTCTCTTCTAATCCGTTTTTGGGCGAGCAAGATTTTTCTCCA TTTGGTGGGTATCCTGCTTCATCGTTCCCACTTATGATAGATGAAAAGGAAGAAGATGAT TATTTACACAATCCTGACCCCGAAGAAGAGGCAAGACTGGATAGAAGGAGGTTCATAGAT GACTTCAAGTACATGGATAAAAGGTCTGCTAGTGGGCTAGCTGGTGTATTGCTCTTGTTT CTGGCAGCCATCTTTATTTTTATTGTTTTGCCAGCGTTGACCTTTACCGGTGCTATTGAT CACGAAAGCAACACTGAAGAAGTTACATATTTAACTCAATACCAATATCCTCAACTATCC GCCATTAGAACATCTCTGGTTGACCCAGAGACACCTGATACAGCGAAGACAAGAGAAGCT ATGGATGGGTCTAAGTGGGAATTAGTATTTTCTGATGAGTTTAATGCAGAAGGGAGAACA TTTTATGATGGGGATGATCCATACTGGACAGCCCCTGATGTTCACTATGATGCTACTAAG GATTTAGAATGGTACAGTCCAGACGCTTCCACAACTGTGAACGGAACCTTGCAGCTGAGA ATGGATGCCTTTAAGAACCATGGCTTATATTACAGATCAGGTATGTTGCAGAGTTGGAAT AAGGTTTGTTTCACGCAGGGTGCTCTAGAAATCTCTGCAAATCTACCAAATTATGGCCGT GTTTCAGGTTTGTGGCCCGGTCTTTGGACTATGGGTAATTTAGGGAGGCCCGGTTATTTG GCTAGTACCCAAGGTGTCTGGCCTTATTCTTATGAATCGTGTGATGCTGGTATTACACCC AACCAAAGTTCCCCGGATGGTATTTCTTACTTGCCGGGACAAAAGTTAAGTATTTGTACT TGTGATGTTGAAGATCATCCGAATCAAGGTGTTGGTAGAGGAGCTCCAGAAATTGATGTT TTGGAAGGTGAAACTGATACTAAGATTGGTGTAGGTATAGCCTCTCAATCCTTGCAAATT GCACCTTTTGATATCTGGTACATGCCTGACTATGATTTTATCGAGGTTTACAATTTCACA ACAACGACCATGAACACTTATGCTGGCGGTCCATTTCAACAAGCCGTATCTGCTGTCTCA ACTTTGAACGTAACTTGGTATGAATTCGGTGAGTACGGTGGCTACTTTCAAAAATATGCC ATTGAGTATCTGAACGATGACGACAATGGTTATATCCGTTGGTTTGTTGGTGATACTCCA ACTTATACTATTCATGCTAAAGCCTTACATCCTGATGGTAATATTGGTTGGAGAAGAATC AGTAAAGAACCAATGTCGATTATTCTAAATCTGGGTATTTCCAACAATTGGGCTTATATT GATTGGCAGTATATTTTCTTCCCAGTGGTTATGTCGATTGACTATGTTAGAATATACCAA CCAAGTAATGCTATATCCGTGACATGCGATCCAAGTGACTATCCAACATATGATTATATT CAATCGCACTTAAATGCATTCCAGAATGCAAACTTAACTACTTGGGAAGATGCTGGTTAC ACGTTCCCTAAGAATATCCTAACTGGTAAATGTACTAGCTCGAAGTTCAAGTTATCCTCT TAA
Protein Properties
Pfam Domain Function
Protein Residues720
Protein Molecular Weight80122.10156
Protein Theoretical pI4.27
Signalling Regions
  • None
Transmembrane Regions
  • 253-273
Protein Sequence>Beta-glucan synthesis-associated protein KRE6 MPLRNLTETHNFSSTNLDTDGTGDDHDGAPLSSSPSFGQQNDNSTNDNAGLTNPFMGSDE ESNARDGESLSSSVHYQPQGSDSSLLHDNSRLDLSQNKGVSDYKGYYSRNNSRAVSTAND NSFLQPPHRAIASSPSLNSNLSKNDILSPPEFDRYPLVGSRVTSMTQLNHHGRSPTSSPG NESSASFSSNPFLGEQDFSPFGGYPASSFPLMIDEKEEDDYLHNPDPEEEARLDRRRFID DFKYMDKRSASGLAGVLLLFLAAIFIFIVLPALTFTGAIDHESNTEEVTYLTQYQYPQLS AIRTSLVDPDTPDTAKTREAMDGSKWELVFSDEFNAEGRTFYDGDDPYWTAPDVHYDATK DLEWYSPDASTTVNGTLQLRMDAFKNHGLYYRSGMLQSWNKVCFTQGALEISANLPNYGR VSGLWPGLWTMGNLGRPGYLASTQGVWPYSYESCDAGITPNQSSPDGISYLPGQKLSICT CDGEDHPNQGVGRGAPEIDVLEGETDTKIGVGIASQSLQIAPFDIWYMPDYDFIEVYNFT TTTMNTYAGGPFQQAVSAVSTLNVTWYEFGEYGGYFQKYAIEYLNDDDNGYIRWFVGDTP TYTIHAKALHPDGNIGWRRISKEPMSIILNLGISNNWAYIDWQYIFFPVVMSIDYVRIYQ PSNAISVTCDPSDYPTYDYIQSHLNAFQNANLTTWEDAGYTFPKNILTGKCTSSKFKLSS
References
External Links
ResourceLink
Saccharomyces Genome Database KRE6
Uniprot IDP32486
Uniprot NameKRE6_YEAST
GenBank Gene IDL33835
Genebank Protein ID499699
General Reference
  • Roemer, T., Bussey, H. (1991). "Yeast beta-glucan synthesis: KRE6 encodes a predicted type II membrane protein required for glucan synthesis in vivo and for glucan synthase activity in vitro." Proc Natl Acad Sci U S A 88:11295-11299.1837148
  • Roemer, T., Fortin, N., Bussey, H. (1994). "DNA sequence analysis of a 10.4 kbp region on the right arm of yeast chromosome XVI positions GPH1 and SGV1 adjacent to KRE6, and identifies two novel tRNA genes." Yeast 10:1527-1530.7871892
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Roemer, T., Paravicini, G., Payton, M. A., Bussey, H. (1994). "Characterization of the yeast (1-->6)-beta-glucan biosynthetic components, Kre6p and Skn1p, and genetic interactions between the PKC1 pathway and extracellular matrix assembly." J Cell Biol 127:567-579.7929594
  • Montijn, R. C., Vink, E., Muller, W. H., Verkleij, A. J., Van Den Ende, H., Henrissat, B., Klis, F. M. (1999). "Localization of synthesis of beta1,6-glucan in Saccharomyces cerevisiae." J Bacteriol 181:7414-7420.10601196
  • Li, H., Page, N., Bussey, H. (2002). "Actin patch assembly proteins Las17p and Sla1p restrict cell wall growth to daughter cells and interact with cis-Golgi protein Kre6p." Yeast 19:1097-1112.12237851
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Bowen, S., Wheals, A. E. (2004). "Incorporation of Sed1p into the cell wall of Saccharomyces cerevisiae involves KRE6." FEMS Yeast Res 4:731-735.15093776
  • Nakamata, K., Kurita, T., Bhuiyan, M. S., Sato, K., Noda, Y., Yoda, K. (2007). "KEG1/YFR042w encodes a novel Kre6-binding endoplasmic reticulum membrane protein responsible for beta-1,6-glucan synthesis in Saccharomyces cerevisiae." J Biol Chem 282:34315-34324.17893149
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956