You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSqualene monooxygenase
Synonyms
  • Squalene epoxidase
  • SE
Gene NameERG1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway
Cellular LocationMicrosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(12:0)PW002548 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(16:0)PW002550 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
squalene + oxygen + NADPH(S)-2,3-epoxysqualene + water + NADP
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00727(S)-2,3-epoxysqualeneShow
YMDB00769squaleneShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00900oxygenShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
purine nucleoside binding
adenyl nucleotide binding
FAD or FADH2 binding
oxidoreductase activity
monooxygenase activity
squalene monooxygenase activity
catalytic activity
binding
nucleoside binding
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR175C
Gene Sequence>1491 bp ATGTCTGCTGTTAACGTTGCACCTGAATTGATTAATGCCGACAACACAATTACCTACGAT GCGATTGTCATCGGTGCTGGTGTTATCGGTCCATGTGTTGCTACTGGTCTAGCAAGAAAG GGTAAGAAAGTTCTTATCGTAGAACGTGACTGGGCTATGCCTGATAGAATTGTTGGTGAA TTGATGCAACCAGGTGGTGTTAGAGCATTGAGAAGTCTGGGTATGATTCAATCTATCAAC AACATCGAAGCATATCCTGTTACCGGTTATACCGTCTTTTTCAACGGCGAACAAGTTGAT ATTCCATACCCTTACAAGGCCGATATCCCTAAAGTTGAAAAATTGAAGGACTTGGTCAAA GATGGTAATGACAAGGTCTTGGAAGACAGCACTATTCACATCAAGGATTACGAAGATGAT GAAAGAGAAAGGGGTGTTGCTTTTGTTCATGGTAGATTCTTGAACAACTTGAGAAACATT ACTGCTCAAGAGCCAAATGTTACTAGAGTGCAAGGTAACTGTATTGAGATATTGAAGGAT GAAAAGAATGAGGTTGTTGGTGCCAAGGTTGACATTGATGGCCGTGGCAAGGTGGAATTC AAAGCCCACTTGACATTTATCTGTGACGGTATCTTTTCACGTTTCAGAAAGGAATTGCAC CCAGACCATGTTCCAACTGTCGGTTCTTCGTTTGTCGGTATGTCTTTGTTCAATGCTAAG AATCCTGCTCCTATGCACGGTCACGTTATTTTTGGTAGTGATCATATGCCAATCTTGGTT TACCAAATCAGTCCAGAAGAAACAAGAATCCTTTGTGCTTACAACTCTCCAAAGGTCCCA GCTGATATCAAGAGTTGGATGATTAAGGATGTCCAACCTTTCATTCCAAAGAGTCTACGT CCTTCATTTGATGAAGCCGTCAGCCAAGGTAAATTTAGAGCTATGCCAAACTCCTACTTG CCAGCTAGACAAAACGACGTCACTGGTATGTGTGTTATCGGTGACGCTCTAAATATGAGA CATCCATTGACTGGTGGTGGTATGACTGTCGGTTTGCATGATGTTGTCTTGTTGATTAAG AAAATAGGTGACCTAGACTTCAGCGACCGTGAAAAGGTTTTGGATGAATTACTAGACTAC CATTTCGAAAGAAAGAGTTACGATTCCGTTATTAACGTTTTGTCAGTGGCTTTGTATTCT TTGTTCGCTGCTGACAGCGATAACTTGAAGGCATTACAAAAAGGTTGTTTCAAATATTTC CAAAGAGGTGGCGATTGTGTCAACAAACCCGTTGAATTTCTGTCTGGTGTCTTGCCAAAG CCTTTGCAATTGACCAGGGTTTTCTTCGCTGTCGCTTTTTACACCATTTACTTGAACATG GAAGAACGTGGTTTCTTGGGATTACCAATGGCTTTATTGGAAGGTATTATGATTTTGATC ACAGCTATTAGAGTATTCACCCCATTTTTGTTTGGTGAGTTGATTGGTTAA
Protein Properties
Pfam Domain Function
Protein Residues496
Protein Molecular Weight55125.39844
Protein Theoretical pI6.44
Signalling Regions
  • None
Transmembrane Regions
  • 17-37
  • 475-495
Protein Sequence>Squalene monooxygenase MSAVNVAPELINADNTITYDAIVIGAGVIGPCVATGLARKGKKVLIVERDWAMPDRIVGE LMQPGGVRALRSLGMIQSINNIEAYPVTGYTVFFNGEQVDIPYPYKADIPKVEKLKDLVK DGNDKVLEDSTIHIKDYEDDERERGVAFVHGRFLNNLRNITAQEPNVTRVQGNCIEILKD EKNEVVGAKVDIDGRGKVEFKAHLTFICDGIFSRFRKELHPDHVPTVGSSFVGMSLFNAK NPAPMHGHVILGSDHMPILVYQISPEETRILCAYNSPKVPADIKSWMIKDVQPFIPKSLR PSFDEAVSQGKFRAMPNSYLPARQNDVTGMCVIGDALNMRHPLTGGGMTVGLHDVVLLIK KIGDLDFSDREKVLDELLDYHFERKSYDSVINVLSVALYSLFAADSDNLKALQKGCFKYF QRGGDCVNKPVEFLSGVLPKPLQLTRVFFAVAFYTIYLNMEERGFLGLPMALLEGIMILI TAIRVFTPFLFGELIG
References
External Links
ResourceLink
Saccharomyces Genome Database ERG1
Uniprot IDP32476
Uniprot NameERG1_YEAST
GenBank Gene IDM64994
Genebank Protein ID171471
General Reference
  • Jandrositz, A., Turnowsky, F., Hogenauer, G. (1991). "The gene encoding squalene epoxidase from Saccharomyces cerevisiae: cloning and characterization." Gene 107:155-160.1743514
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Hitchcock, A. L., Auld, K., Gygi, S. P., Silver, P. A. (2003). "A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery." Proc Natl Acad Sci U S A 100:12735-12740.14557538
  • Mo, C., Bard, M. (2005). "Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex." J Lipid Res 46:1991-1998.15995173
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258